Rv3033 Resolved · medium

H37Rv Rv3033 · MTBC0 mtbc0_003225 · 182 aa · 3414690–3415238 (+) · RefSeq NP_217549.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF4333 domain-containing protein
Revised (this work)Secreted anti-apoptotic virulence factor. RefSeq leaves it 'hypothetical'. Rv3033 represses the intrinsic (caspase-9-mediated) but not the extrinsic apoptotic pathway in infected macrophages, blocking both mitochondrial cytochrome-c release and ER-stress (PERK) activation, thereby promoting bacillary survival (Zhang 2018).

Curated reference (UniProt)

UniProt I6YAY5 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDUF4333 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF4333)
Orthologous group2E9A0

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.633 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.63% of strains (914) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4333PF14230.12 2.6e-2223–97 Domain of unknown function (DUF4333)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 91.5 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
4lmi-assembly1_A 0.60 0.63 1.6e+00 4lmi-assembly1_A Crystal structure of putative ketosteroid isomerase from Kribbella flavida DSM 17836
6w3w-assembly1_A 0.51 0.60 1.8e+00 6w3w-assembly1_A An enumerative algorithm for de novo design of proteins with diverse pocket structures
4r80-assembly2_B 0.33 0.51 2.0e+00 4r80-assembly2_B Crystal Structure of a De Novo Designed Beta Sheet Protein, Cystatin Fold, Northeast Structural Genomics Consortium (NESG) Target OR486
8bl9-assembly1_A 0.30 0.55 2.7e+00 8bl9-assembly1_A Crystal Structure of Sam0.7
5trv-assembly1_A 0.30 0.50 2.0e+00 5trv-assembly1_A Crystal structure of a de novo designed protein with curved beta-sheet
5tph-assembly1_A 0.30 0.61 3.7e+00 5tph-assembly1_A Crystal structure of a de novo designed protein homodimer with curved beta-sheet
3en8-assembly1_A-2 0.30 0.52 2.7e+00 3en8-assembly1_A-2 Crystal structure of NTF-2 like protein of unknown function (YP_553245.1) from BURKHOLDERIA XENOVORANS LB400 at 1.85 A resolution
5l33-assembly1_A 0.21 0.68 4.6e+00 5l33-assembly1_A Crystal structure of a de novo designed protein with curved beta-sheet

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0479c (membrane protein), medium confidence from genomic context alone (score 591 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1006 hyp hypothetical protein 765 765 ctx cooccurence:764
Rv1868 hyp hypothetical protein 761 761 ctx cooccurence:760
Rv1435c hyp hypothetical protein 745 745 ctx cooccurence:745
Rv2047c hyp hypothetical protein 698 698 ctx cooccurence:698
Rv2598 hyp hypothetical protein 688 688 ctx cooccurence:685
Rv0210 hyp hypothetical protein 631 631 ctx cooccurence:631
Rv2114 hyp hypothetical protein 626 626 ctx cooccurence:624
Rv0479c membrane protein 591 591 ctx cooccurence:588
Rv3166c hyp hypothetical protein 589 589 ctx cooccurence:583
Rv0180c transmembrane protein 563 563 ctx cooccurence:563
Rv2597 membrane protein 558 559 ctx cooccurence:558
Rv3448 eccD4 ESX-4 secretion system protein EccD4 543 543 ctx cooccurence:542
Rv1364c sigma factor regulatory protein 510 511 ctx cooccurence:508
Rv2560 hyp hypothetical protein 497 498 ctx cooccurence:496
Rv3450c eccB4 ESX-4 secretion system protein EccB4 493 493 ctx cooccurence:490

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Secreted virulence factor; represses intrinsic (caspase-9) apoptosis (Zhang 2018, PMID 30319611)
  • Blocks mitochondrial cytochrome-c release and PERK ER-stress branch
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217549.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4333 (PF14230.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E9A0
  • Curated reference: UniProt I6YAY5 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 91.5, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 33 functional partner(s); context anchor Rv0479c
  • Primary literature: Zhang W, Lu Q, Dong Y, Yue Y, Xiong S (2018). Rv3033, as an Emerging Anti-apoptosis Factor, Facilitates Mycobacteria Survival via Inhibiting Macrophage Intrinsic Apoptosis Front Immunol 9:2136. doi:10.3389/fimmu.2018.02136 PMID:30319611

Ancestral MTBC0 protein sequence

>mtbc0_003225|Rv3033|
MAHSIVRTLLASGAATALIAIPTACSFSIGTSHSHSVSKAEVARQITAKMTDAAGNKPESVTCPSDLPAEVGAELNCEMKIKDRTFNVNVTVTSVDGSDVKFDMVETVDKNQVANIISDKLFQRVGARPDSVTCPDNLKGVEGAKLRCRLTDGSKTYGISVIVTSVDAGDVNFDFKVDDHPE