echA17 Resolved · high auto-curated

H37Rv Rv3039c · MTBC0 mtbc0_003231 · 254 aa · 3420729–3421493 (-) · RefSeq NP_217555.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)enoyl-CoA hydratase EchA17
MTBC0 PGAP re-annotationenoyl-CoA hydratase
Revised (this work)Enoyl-CoA hydratase. Pfam: ECH_1 (PF00378.26), ECH_2 (PF16113.11).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNN3 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable enoyl-CoA hydratase EchA17
EC (curated) EC 4.2.1.17
Curated functionCould possibly oxidize fatty acids using specific components.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred nameechA17
eggNOG descriptionEnoyl-CoA hydratase
Orthologous groupCOG1024
EC number EC 4.2.1.17
KEGG orthology K01692
KEGG pathways map00071, map00280, map00281, map00310, map00360, map00362, map00380, map00410, map00627, map00640, map00650, map00903, map00930, map01100, map01110, map01120, map01130, map01212
KEGG modules M00032, M00087
Gene Ontology (41) GO:0003674, GO:0003824, GO:0004300, GO:0005575, GO:0005623, GO:0005886, GO:0006082, GO:0006629, GO:0006631, GO:0006635, GO:0008150, GO:0008152 +29 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.718 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ECH_1PF00378.26 1.3e-4515–240 Enoyl-CoA hydratase/isomerase
ECH_2PF16113.11 2.8e-2020–199 Enoyl-CoA hydratase/isomerase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadB2 (3-hydroxybutyryl-CoA dehydrogenase), high confidence from genomic context alone (score 967 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0468 fadB2 3-hydroxybutyryl-CoA dehydrogenase 968 967 ctx fusion:790 cooccurence:418 database:650
Rv1715 fadB3 3-hydroxybutyryl-CoA dehydrogenase FadB 935 933 ctx fusion:617 database:650
Rv3040c hyp hypothetical protein 913 913 ctx neighborhood:881
Rv3041c ABC transporter ATP-binding protein 899 900 ctx neighborhood:881
Rv3038c hyp hypothetical protein 879 880 ctx neighborhood:879
Rv3042c serB2 phosphoserine phosphatase SerB 870 871 ctx neighborhood:869
Rv0231 fadE4 acyl-CoA dehydrogenase FadE4 850 845 database:750
Rv0154c fadE2 acyl-CoA dehydrogenase FadE2 850 845 database:750
Rv3140 fadE23 acyl-CoA dehydrogenase FadE23 858 844 database:750
Rv0400c fadE7 acyl-CoA dehydrogenase FadE7 850 844 database:750
Rv0975c fadE13 acyl-CoA dehydrogenase FadE13 849 844 database:750
Rv2500c fadE19 acyl-CoA dehydrogenase FadE19 849 844 database:750
Rv0131c fadE1 acyl-CoA dehydrogenase FadE1 849 844 database:750
Rv3043c ctaD cytochrome C oxidase cytochrome 1 805 802 ctx neighborhood:801
Rv2524c fas fatty acid synthase 816 790 coexpression:647

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: enoyl-CoA hydratase EchA17
  • MTBC0 PGAP product: enoyl-CoA hydratase
  • Pfam (hmmscan --cut_ga): ECH_1 PF00378.26 (E=1e-45), ECH_2 PF16113.11 (E=3e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217555.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ECH_1 (PF00378.26), ECH_2 (PF16113.11)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1024
  • Curated reference: UniProt P9WNN3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 155 functional partner(s); context anchor fadB2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003231|Rv3039c|echA17
MPEFVNVVVSDGSQDAGLAMLLLSRPPTNAMTRQVYREVVAAANELGRRDDVAAVILYGGHEIFSAGDDMPELRTLSAQEADTAARIRQQAVDAVAAIPKPTVAAITGYALGAGLTLALAADWRVSGDNVKFGATEILAGLIPSGDGMARLTRAAGPSRAKELVFSGRFFDAEEALALGLIDDMVAPDDVYDAAAAWARRFLDGPPHALAAAKAGISDVYELAPAERIAAERRRYVEVFAAGQGGGSKGDRGGR