Rv3032A Family assigned · low

H37Rv Rv3032A · MTBC0 - · 129 aa · 3392812–3393201 (+) · RefSeq YP_004837058.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Membrane metalloprotease-like fold (YxkI-like). RefSeq leaves it 'hypothetical protein'.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6X630 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2C72U

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 70.3 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
4khb-assembly4_G 0.63 0.50 4.0e-01 4khb-assembly4_G Structure of the Spt16D Pob3N heterodimer
4khb-assembly1_A 0.51 0.49 4.2e-01 4khb-assembly1_A Structure of the Spt16D Pob3N heterodimer
4khb-assembly3_E 0.41 0.50 6.2e-01 4khb-assembly3_E Structure of the Spt16D Pob3N heterodimer
4khb-assembly2_C 0.38 0.47 5.0e-01 4khb-assembly2_C Structure of the Spt16D Pob3N heterodimer
2gcl-assembly2_B 0.18 0.57 3.9e+00 2gcl-assembly2_B Structure of the Pob3 Middle domain
4tyz-assembly2_B 0.15 0.47 2.3e+00 4tyz-assembly2_B Crystal structure of the C-terminal domain of an unknown protein from Leishmania infantum
8xgc-assembly1_M 0.11 0.36 1.2e+00 8xgc-assembly1_M Structure of yeast replisome associated with FACT and histone hexamer, Composite map
3to1-assembly1_A 0.07 0.47 7.3e+00 3to1-assembly1_A Two surfaces on Rtt106 mediate histone binding and chaperone activity

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3032 (glycogen synthase), high confidence from genomic context alone (score 752 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3032 glycogen synthase 752 752 ctx neighborhood:752
Rv3030 S-adenosylmethionine-dependent methyltransferase 585 585 ctx neighborhood:585
Rv3031 1,4-alpha-glucan-branching protein 585 585 ctx neighborhood:585
Rv3033 hyp hypothetical protein 485 485 ctx neighborhood:485

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Foldseek vs AFDB-SwissProt: membrane metalloprotease YxkI, TM 0.63, E 4e-3
  • Structural homology vs AlphaFold-Swiss-Prot (Foldseek; 542k curated SwissProt structures), project 'Still unknown gene function' phase13, 2026-06-10. Fold/family-level, not a demonstrated function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_004837058.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2C72U
  • Curated reference: UniProt I6X630 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 70.3, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 4 functional partner(s); context anchor Rv3032
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3032A|
MKPQDQGLHFPYRYDLRLAPMWLPFRWPGSQGVTVTEDGRFVARYGPFRVEAPLSSVRDAHITGPYRWWTAVGPRLSMVDDGLTFGTNAAAGVCIHFEPRIHRVIGLRDHSALTVTVADPEGLVAALSS