trmU Resolved · high auto-curated

H37Rv Rv3024c · MTBC0 mtbc0_003215 · 367 aa · 3404095–3405198 (-) · RefSeq NP_217540.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)tRNA-specific 2-thiouridylase
MTBC0 PGAP re-annotationtRNA 2-thiouridine(34) synthase MnmA
Revised (this work)TRNA 2-thiouridine(34) synthase MnmA. Pfam: tRNA_Me_trans (PF03054.23), ThiI (PF02568.21), tRNA_Me_trans_M (PF20259.4), tRNA_Me_trans_C (PF20258.5).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJS5 SwissProt · reviewed · Evidence at protein level
UniProt nametRNA-specific 2-thiouridylase MnmA
EC (curated) EC 2.8.1.13
Curated functionCatalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namemnmA
eggNOG descriptionCatalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34
Orthologous groupCOG0482
EC number EC 2.8.1.13
KEGG orthology K00566
KEGG pathways map04122

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.452 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
tRNA_Me_transPF03054.23 6.5e-761–196 tRNA methyl transferase HUP domain
ThiIPF02568.21 1.8e-042–34 Thiamine biosynthesis protein (ThiI)
tRNA_Me_trans_MPF20259.4 1.6e-20201–268 tRNA methyl transferase PRC-barrel domain
tRNA_Me_trans_CPF20258.5 5.9e-17275–353 Aminomethyltransferase beta-barrel domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: iscS (cysteine desulfurase), high confidence from genomic context alone (score 939 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3025c iscS cysteine desulfurase 953 939 ctx neighborhood:881 coexpression:406
Rv3027c GCN5-like N-acetyltransferase 776 776 ctx neighborhood:775
Rv3028c fixB electron transfer flavoprotein subunit alpha 683 683 ctx neighborhood:680
Rv0904c accD3 acetyl-CoAcarboxylase carboxyl transferase subunit beta 678 679 coexpression:659
Rv3026c hyp hypothetical protein 625 625 ctx neighborhood:623
Rv3029c fixA electron transfer flavoprotein subunit beta 582 572 ctx neighborhood:568
Rv1901 cinA competence damage-inducible protein CinA 517 518
Rv1409 ribG bifunctional riboflavin biosynthesis diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino) uracil reductas 683 486 coexpression:401 textmining:410
Rv1334 mec [CysO 473 473
Rv3023c transposase 473 473 ctx neighborhood:468
Rv3610c ftsH zinc metalloprotease FtsH 477 453
Rv1691 hyp hypothetical protein 451 452 database:420
Rv3923c rnpA ribonuclease P protein component 518 446 coexpression:414
Rv2267c stf3 hyp hypothetical protein 446 446 database:420
Rv3529c hyp hypothetical protein 446 446 database:420

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: tRNA-specific 2-thiouridylase
  • MTBC0 PGAP product: tRNA 2-thiouridine(34) synthase MnmA
  • Pfam (hmmscan --cut_ga): tRNA_Me_trans PF03054.23 (E=7e-76), ThiI PF02568.21 (E=2e-04), tRNA_Me_trans_M PF20259.4 (E=2e-20), tRNA_Me_trans_C PF20258.5 (E=6e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217540.1)
  • Domains: Pfam-A via hmmscan --cut_ga — tRNA_Me_trans (PF03054.23), ThiI (PF02568.21), tRNA_Me_trans_M (PF20259.4), tRNA_Me_trans_C (PF20258.5)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0482
  • Curated reference: UniProt P9WJS5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 33 functional partner(s); context anchor iscS
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003215|Rv3024c|trmU
MKVLAAMSGGVDSSVAAARMVDAGHEVVGVHMALSTAPGTLRTGSRGCCSKEDAADARRVADVLGIPFYVWDFAEKFKEDVINDFVSSYARGETPNPCVRCNQQIKFAALSARAVALGFDTVATGHYARLSGGRLRRAVDRDKDQSYVLAVLTAQQLRHAAFPIGDTPKRQIRAEAARRGLAVANKPDSHDICFIPSGNTKAFLGERIGVRRGVVVDADGVVLASHDGVHGFTIGQRRGLGIAGPGPNGRPRYVTAIDADTATVHVGDVTDLDVQTLTGRAPVFTAGAAPSGPVDCVVQVRAHGETVSAVAELIGDALFVQLHAPLRGVARGQTLVLYRPDPAGDEVLGSATIAGASGLSTGGNPGA