Rv0238 Family assigned · medium auto-curated

H37Rv Rv0238 · MTBC0 mtbc0_000254 · 204 aa · 288809–289423 (+) · RefSeq NP_214752.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotationTetR/AcrR family transcriptional regulator
Revised (this work)TetR/AcrR family transcriptional regulator. Pfam: TetR_N (PF00440.30), TetR_C_46 (PF21943.2).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53661 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible transcriptional regulatory protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG1309

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.063 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TetR_NPF00440.30 1.2e-1618–63 Bacterial regulatory proteins, tetR family
TetR_C_46PF21943.2 3.4e-2485–191 Tetracyclin repressor-like, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lpqI (lipoprotein LpqI), high confidence from genomic context alone (score 746 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0237 lpqI lipoprotein LpqI 746 746 ctx neighborhood:743
Rv0239 vapB24 antitoxin VapB24 649 649 ctx neighborhood:637
Rv0240 vapC24 ribonuclease VapC24 642 641 ctx neighborhood:636
Rv0158 transcriptional regulator 634 635 ctx cooccurence:445
Rv1534 transcriptional regulator 551 552 ctx cooccurence:545
Rv0236A hyp hypothetical protein 521 521 ctx neighborhood:518
Rv3208 TetR family transcriptional regulator 421 422
Rv1014c pth peptidyl-tRNA hydrolase 400 401
Rv2506 TetR family transcriptional regulator 870 369 textmining:803
Rv0472c HTH-type transcriptional regulator 529 223 textmining:419
Rv3050c AsnC family transcriptional regulator 818 87 textmining:809
Rv2760c vapB42 antitoxin VapB42 811 84 textmining:803
Rv1423 whiA transcriptional regulator WhiA 859 68 textmining:855
Rv0348 mosR transcriptional regulator 661 55 textmining:656
Rv1828 HTH-type transcriptional regulator 559 53 textmining:554

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator
  • MTBC0 PGAP product: TetR/AcrR family transcriptional regulator
  • Pfam (hmmscan --cut_ga): TetR_N PF00440.30 (E=1e-16), TetR_C_46 PF21943.2 (E=3e-24)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214752.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TetR_N (PF00440.30), TetR_C_46 (PF21943.2)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1309
  • Curated reference: UniProt O53661 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor lpqI
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000254|Rv0238|
MAGGTKRLPRAVREQQMLDAAVQMFSVNGYHETSMDAIAAEAQISKPMLYLYYGSKEDLFGACLNREMSRFIDALRSSINFDQSPKDLLRNTIVSFLRYIDANRASWIVMYTQATSSQAFAHTVREGREQIVQLVAELVRAGTRGPLTDAEIEMMAVALVGAGEAVATRLGIGDTDVDEAAEMMINLFWLGLKGAPVDRLETGH