esxQ Resolved · medium auto-curated

H37Rv Rv3017c · MTBC0 mtbc0_003206 · 120 aa · 3397799–3398161 (-) · RefSeq NP_217533.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESAT-6 like protein EsxQ
MTBC0 PGAP re-annotationtype VII secretion system ESX-3 effector EsxQ
Revised (this work)Type VII secretion system ESX-3 effector EsxQ.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNJ1 SwissProt · reviewed · Inferred from homology
UniProt nameESAT-6-like protein EsxQ

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameesxH
eggNOG descriptionprotein secretion by the type VII secretion system
Orthologous groupCOG4842
KEGG orthology K14956
KEGG pathways map05152

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.325 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PPE46 (PPE family protein PPE46), medium confidence from genomic context alone (score 562 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3020c esxS ESAT-6 like protein EsxS 980 866 experimental:822 textmining:859
Rv0287 esxG ESAT-6 like protein EsxG 915 833 experimental:822 textmining:517
Rv3018c PPE46 PPE family protein PPE46 638 562 ctx neighborhood:556
Rv0284 eccC3 ESX-3 secretion system protein EccC3 439 404
Rv3018A PE27A Rv3018A, len: 28 aa. PE27A, Member of Mycobacterium tuberculosis PE family (see Brennan and Delogu, 2002), most similar to Rv0285 (102 aa), 576 401 ctx neighborhood:401
Rv3022A PE29 PE family protein PE29 591 93 textmining:568
Rv0894 transcriptional regulator 630 47 textmining:628
Rv3875 esxA ESAT-6 protein EsxA 543 47 textmining:540
Rv1038c esxJ ESAT-6 like protein EsxJ 541 47 textmining:539
Rv3738c PPE66 PPE family protein PPE66 430 46 textmining:428
Rv1816 HTH-type transcriptional regulator 544 44 textmining:543
Rv1668c Rv1668c, (MTV047.04c), len: 372 aa. Probable first part of macrolide-transport ATP-binding protein ABC transporter (see citation below), sim 512 44 textmining:511
Rv1304 atpB ATP synthase subunit A 408 43 textmining:407
Rv1519 hyp hypothetical protein 547 41 textmining:547
Rv0583c lpqN lipoprotein LpqN 430 41 textmining:430

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESAT-6 like protein EsxQ
  • MTBC0 PGAP product: type VII secretion system ESX-3 effector EsxQ
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217533.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4842
  • Curated reference: UniProt P9WNJ1 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor PPE46
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003206|Rv3017c|esxQ
MSQSMYSYPAMTANVGDMAGYTGTTQSLGADIASERTAPSRACQGDLGMSHQDWQAQWNQAMEALARAYRRCRRALRQIGVLERPVGDSSDCGTIRVGSFRGRWLDPRHAGPATAADAGD