esxQ Resolved · medium auto-curated
H37Rv Rv3017c · MTBC0 mtbc0_003206 ·
120 aa · 3397799–3398161 (-) ·
RefSeq NP_217533.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ESAT-6 like protein EsxQ |
|---|---|
| MTBC0 PGAP re-annotation | type VII secretion system ESX-3 effector EsxQ |
| Revised (this work) | Type VII secretion system ESX-3 effector EsxQ. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WNJ1
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | ESAT-6-like protein EsxQ |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | esxH |
| eggNOG description | protein secretion by the type VII secretion system |
| Orthologous group | COG4842 |
| KEGG orthology |
K14956
|
| KEGG pathways |
map05152
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.325 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PPE46 (PPE family protein PPE46), medium confidence from genomic context alone (score 562 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3020c esxS |
ESAT-6 like protein EsxS | 980 | 866 | experimental:822 textmining:859 |
Rv0287 esxG |
ESAT-6 like protein EsxG | 915 | 833 | experimental:822 textmining:517 |
Rv3018c PPE46 |
PPE family protein PPE46 | 638 | 562 ctx | neighborhood:556 |
Rv0284 eccC3 |
ESX-3 secretion system protein EccC3 | 439 | 404 | |
Rv3018A PE27A |
Rv3018A, len: 28 aa. PE27A, Member of Mycobacterium tuberculosis PE family (see Brennan and Delogu, 2002), most similar to Rv0285 (102 aa), | 576 | 401 ctx | neighborhood:401 |
Rv3022A PE29 |
PE family protein PE29 | 591 | 93 | textmining:568 |
Rv0894 |
transcriptional regulator | 630 | 47 | textmining:628 |
Rv3875 esxA |
ESAT-6 protein EsxA | 543 | 47 | textmining:540 |
Rv1038c esxJ |
ESAT-6 like protein EsxJ | 541 | 47 | textmining:539 |
Rv3738c PPE66 |
PPE family protein PPE66 | 430 | 46 | textmining:428 |
Rv1816 |
HTH-type transcriptional regulator | 544 | 44 | textmining:543 |
Rv1668c |
Rv1668c, (MTV047.04c), len: 372 aa. Probable first part of macrolide-transport ATP-binding protein ABC transporter (see citation below), sim | 512 | 44 | textmining:511 |
Rv1304 atpB |
ATP synthase subunit A | 408 | 43 | textmining:407 |
Rv1519 hyp |
hypothetical protein | 547 | 41 | textmining:547 |
Rv0583c lpqN |
lipoprotein LpqN | 430 | 41 | textmining:430 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ESAT-6 like protein EsxQ
- MTBC0 PGAP product: type VII secretion system ESX-3 effector EsxQ
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217533.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4842 - Curated reference: UniProt P9WNJ1 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
15 functional partner(s); context anchor
PPE46 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003206|Rv3017c|esxQ MSQSMYSYPAMTANVGDMAGYTGTTQSLGADIASERTAPSRACQGDLGMSHQDWQAQWNQAMEALARAYRRCRRALRQIGVLERPVGDSSDCGTIRVGSFRGRWLDPRHAGPATAADAGD