gatC Family assigned · medium auto-curated

H37Rv Rv3012c · MTBC0 mtbc0_003201 · 99 aa · 3392740–3393039 (-) · RefSeq NP_217528.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glutamyl-tRNA(GLN) amidotransferase subunit C
MTBC0 PGAP re-annotationAsp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC
Revised (this work)Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC. Pfam: GatC (PF02686.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WN59 SwissProt · reviewed · Evidence at protein level
UniProt nameGlutamyl-tRNA(Gln) amidotransferase subunit C
EC (curated) EC 6.3.5.-
Curated functionAllows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namegatC
eggNOG descriptionAllows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp- tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln)
Orthologous groupCOG0721
EC number EC 6.3.5.6, EC 6.3.5.7
KEGG orthology K02435
KEGG pathways map00970, map01100
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.335 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GatCPF02686.21 7.8e-2020–91 Glu-tRNAGln amidotransferase C subunit

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: gatB (aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3009c gatB aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B 999 999 ctx neighborhood:578 coexpression:757 experimental:928 database:900 textmining:439
Rv3011c gatA glutamyl-tRNA(GLN) amidotransferase subunit A 999 999 ctx neighborhood:881 coexpression:663 experimental:629 database:900
Rv1307 atpH ATP synthase subunit b/delta 925 923 coexpression:915
Rv3375 amiD amidase 913 903 coexpression:649 experimental:629
Rv2363 amiA2 amidase 905 899 coexpression:656 experimental:629
Rv2888c amiC amidase AmiC 898 892 coexpression:648 experimental:629
Rv1263 amiB2 amidase AmiB 897 891 coexpression:649 experimental:629
Rv3175 amidase 896 890 coexpression:645 experimental:629
Rv2572c aspS aspartate--tRNA ligase 985 871 experimental:836 textmining:895
Rv2753c dapA 4-hydroxy-tetrahydrodipicolinate synthase 736 721 coexpression:698
Rv3010c pfkA 6-phosphofructokinase 668 668 ctx neighborhood:624
Rv0651 rplJ 50S ribosomal protein L10 679 667 coexpression:666
Rv2056c rpsN2 30S ribosomal protein S14 664 665 coexpression:665
Rv0717 rpsN1 30S ribosomal protein S14 663 664 coexpression:664
Rv0641 rplA 50S ribosomal protein L1 656 656 coexpression:652

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glutamyl-tRNA(GLN) amidotransferase subunit C
  • MTBC0 PGAP product: Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC
  • Pfam (hmmscan --cut_ga): GatC PF02686.21 (E=8e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217528.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GatC (PF02686.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0721
  • Curated reference: UniProt P9WN59 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 55 functional partner(s); context anchor gatB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003201|Rv3012c|gatC
MSQISRDEVAHLARLARLALTETELDSFAGQLDAILTHVSQIQAVDVTGVQATDNPLKDVNVTRPDETVPCLTQRQVLDQAPDAVDGRFAVPQILGDEQ