gatC Family assigned · medium auto-curated
H37Rv Rv3012c · MTBC0 mtbc0_003201 ·
99 aa ·
3392740–3393039 MTBC0
(-) ·
RefSeq NP_217528.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | glutamyl-tRNA(GLN) amidotransferase subunit C |
|---|---|
| MTBC0 PGAP re-annotation | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC |
| Revised (this work) | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC. Pfam: GatC (PF02686.21). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 9 publications
9 TB publications mention this gene. 9 publication(s) discuss this gene (9 in a M. tuberculosis context, 4 in other mycobacteria — M. smegmatis (3), M. leprae (1), M. marinum (1)).
| Publication | Date |
|---|---|
| Association of tuberculosis risk with genetic polymorphisms of the immune checkpoint genes PDCD1, CTLA-4, and TIM3. doi:10.1371/journal.pone.0303431 | 2024 |
| Forward Genetics Reveals a gatC-gatA Fusion Polypeptide Causes Mistranslation and Rifampicin Tolerance in Mycobacterium smegmatis. doi:10.3389/fmicb.2020.577756 | 2020 |
| CCL5 (RANTES) gene polymorphisms in pulmonary tuberculosis patients of south India. doi:10.1111/j.1744-313X.2011.01021.x | 2011 |
| Specificity changes in the evolution of type II restriction endonucleases: a biochemical and bioinformatic analysis of restriction enzymes that recognize unrelated sequences. doi:10.1074/jbc.M409020200 | 2005 |
| Lack of GATC sites in the genome of Streptococcus bovis bacteriophage F4. doi:10.1016/s0923-2508(00)00148-0 | 2000 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | gatA (Rv3011c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -7.09 (95% CI -11.89 to -1.40). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Component of the translational apparatus. Furnishes a means for formation of correctly charged GLN-tRNA(GLN) through the transamidation of misacylated GLU- tRNA(GLN) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-GLU-tRNA(GLN) [catalytic activity: ATP + L-glutamyl-tRNA(GLN) + L-glutamine = ADP + p |
|---|---|
| Mycobrowser EC |
6.3.5.-
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3037c
· 99.0% identity |
|---|---|
| M. leprae |
ML1703c
· 75.8% identity |
| M. marinum |
MMAR_1701
· 85.9% identity |
| M. smegmatis |
MSMEG_2364
· 78.8% identity |
| M. orygis |
RJtmp_003112
· 99.0% identity |
| M. abscessus |
MAB_3342c
· 64.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WN59
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Glutamyl-tRNA(Gln) amidotransferase subunit C |
| EC (curated) |
EC 6.3.5.-
|
| Curated function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | gatC |
| eggNOG description | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp- tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) |
| Orthologous group | COG0721 |
| EC number |
EC 6.3.5.6, EC 6.3.5.7
|
| KEGG orthology |
K02435
|
| KEGG pathways |
map00970, map01100
|
| Gene Ontology (6) |
GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.335 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 83.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 10/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 54.0% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | Uncertain · uncertain |
|---|---|
| What the call means | uncertain (short or TA-poor ORF): no call possible |
| Caveat | Statistically thin call: only 0 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 370.0 ppm · rank 541/3519 (84.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 99 aa |
|---|---|
| Molecular weight | 10.7 kDa |
| Theoretical pI | 4.3 |
| GRAVY | -0.181 (hydrophilic) |
| Aliphatic index | 102.4 |
| Aromaticity | 0.02 |
| Instability index | 34.0 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
GatC | PF02686.21 | 7.8e-20 | 20–91 | Glu-tRNAGln amidotransferase C subunit |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3ip4-assembly1_C |
1.00 | 0.95 | 8.0e-07 sig | 3ip4-assembly1_C The high resolution structure of GatCAB |
2g5i-assembly1_C |
1.00 | 0.92 | 5.8e-07 sig | 2g5i-assembly1_C Structure of tRNA-Dependent Amidotransferase GatCAB complexed with ADP-AlF4 |
3h0l-assembly1_C |
1.00 | 0.91 | 7.3e-06 sig | 3h0l-assembly1_C Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus |
4wj3-assembly2_I |
1.00 | 0.89 | 2.5e-05 sig | 4wj3-assembly2_I Crystal structure of the asparagine transamidosome from Pseudomonas aeruginosa |
3kfu-assembly1_G |
1.00 | 0.85 | 3.0e-04 sig | 3kfu-assembly1_G Crystal structure of the transamidosome |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | gatA (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3013 (+ strand, 84 bp gap) |
| Predicted operon |
gatA · gatC
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv0047c (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: gatB (aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3009c gatB exp |
aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B | 999 | 999 ctx | neighborhood:578 coexpression:757 experimental:928 database:900 textmining:439 |
Rv3011c gatA exp |
glutamyl-tRNA(GLN) amidotransferase subunit A | 999 | 999 ctx | neighborhood:881 coexpression:663 experimental:629 database:900 |
Rv1307 atpH |
ATP synthase subunit b/delta | 925 | 923 | coexpression:915 |
Rv3375 amiD exp |
amidase | 913 | 903 | coexpression:649 experimental:629 |
Rv2363 amiA2 exp |
amidase | 905 | 899 | coexpression:656 experimental:629 |
Rv2888c amiC exp |
amidase AmiC | 898 | 892 | coexpression:648 experimental:629 |
Rv1263 amiB2 exp |
amidase AmiB | 897 | 891 | coexpression:649 experimental:629 |
Rv3175 exp |
amidase | 896 | 890 | coexpression:645 experimental:629 |
Rv2572c aspS exp |
aspartate--tRNA ligase | 985 | 871 | experimental:836 textmining:895 |
Rv2753c dapA |
4-hydroxy-tetrahydrodipicolinate synthase | 736 | 721 | coexpression:698 |
Rv3010c pfkA |
6-phosphofructokinase | 668 | 668 ctx | neighborhood:624 |
Rv0651 rplJ |
50S ribosomal protein L10 | 679 | 667 | coexpression:666 |
Rv2056c rpsN2 |
30S ribosomal protein S14 | 664 | 665 | coexpression:665 |
Rv0717 rpsN1 |
30S ribosomal protein S14 | 663 | 664 | coexpression:664 |
Rv0641 rplA |
50S ribosomal protein L1 | 656 | 656 | coexpression:652 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: glutamyl-tRNA(GLN) amidotransferase subunit C
- MTBC0 PGAP product: Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC
- Pfam (hmmscan --cut_ga): GatC PF02686.21 (E=8e-20)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217528.1)
- Domains: Pfam-A via hmmscan --cut_ga — GatC (PF02686.21)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0721 - Curated reference: UniProt P9WN59 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
55 functional partner(s); context anchor
gatB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003201|Rv3012c|gatC MSQISRDEVAHLARLARLALTETELDSFAGQLDAILTHVSQIQAVDVTGVQATDNPLKDVNVTRPDETVPCLTQRQVLDQAPDAVDGRFAVPQILGDEQ
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for gatC? Email the maintainer — the message is pre-filled with this gene's details.