PE29 Family assigned · medium auto-curated

H37Rv Rv3022A · MTBC0 - · 104 aa · 3380679–3380993 (-) · RefSeq YP_177685.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PE family protein PE29
MTBC0 PGAP re-annotation
Revised (this work)PE family protein PE29. Pfam: PE (PF00934.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q6MX17 TrEMBL · unreviewed · Predicted
UniProt namePE family protein PE29

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionCell motility protein
Orthologous group2B7DA

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PEPF00934.26 1.5e-183–92 PE family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PPE48 (Rv3021c, (MTV012.35c), len: 358 aa. PPE47, Member of Mycobacterium tuberculosis PPE family. Should be continuation of upstream ORF MTV012.36), high confidence from genomic context alone (score 798 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3022c PPE48 Rv3021c, (MTV012.35c), len: 358 aa. PPE47, Member of Mycobacterium tuberculosis PPE family. Should be continuation of upstream ORF MTV012.36 867 798 ctx neighborhood:798
Rv3018c PPE46 PPE family protein PPE46 513 161 textmining:444
Rv3020c esxS ESAT-6 like protein EsxS 562 105 textmining:532
Rv3017c esxQ ESAT-6 like protein EsxQ 591 93 textmining:568
Rv3019c esxR ESAT-6 like protein EsxR 433 93 textmining:401
Rv3739c PPE67 PPE family protein PPE67 560 71 textmining:546
Rv2554c ruvX Holliday junction resolvase 698 41 textmining:698
Rv2555c alaS alanine--tRNA ligase 680 41 textmining:680
Rv1806 PE20 PE family protein PE20 572 41 textmining:572
Rv1224 tatB Sec-independent protein translocase protein TatB 545 41 textmining:545
Rv3018A PE27A Rv3018A, len: 28 aa. PE27A, Member of Mycobacterium tuberculosis PE family (see Brennan and Delogu, 2002), most similar to Rv0285 (102 aa), 543 41 textmining:543
Rv3737 transmembrane protein 449 41 textmining:449
Rv2313c hyp hypothetical protein 446 41 textmining:446
Rv2694c hyp hypothetical protein 412 41 textmining:412

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE29
  • Pfam (hmmscan --cut_ga): PE PF00934.26 (E=1e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177685.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B7DA
  • Curated reference: UniProt Q6MX17 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor PPE48
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3022A|PE29
MTLRVVPEGLAAASAAVEALTARLAAAHAGAAPAITAVVAPAADPVSLQSAVGFSALGSEHAAIAGEGVEELGRSGVAVGESGIGYAAGDAVAAATYLVSGGSL