gatA Family assigned · medium auto-curated

H37Rv Rv3011c · MTBC0 mtbc0_003200 · 494 aa · 3391259–3392743 (-) · RefSeq NP_217527.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glutamyl-tRNA(GLN) amidotransferase subunit A
MTBC0 PGAP re-annotationAsp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA
Revised (this work)Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA. Pfam: Amidase (PF01425.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQA1 SwissProt · reviewed · Evidence at protein level
UniProt nameGlutamyl-tRNA(Gln) amidotransferase subunit A
EC (curated) EC 6.3.5.7
Curated functionAllows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln) (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namegatA
eggNOG descriptionAllows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln)
Orthologous groupCOG0154
EC number EC 6.3.5.6, EC 6.3.5.7
KEGG orthology K02433
KEGG pathways map00970, map01100
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.421 · purifying
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AmidasePF01425.27 9.5e-16225–476 Amidase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: gatC (glutamyl-tRNA(GLN) amidotransferase subunit C), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3012c gatC glutamyl-tRNA(GLN) amidotransferase subunit C 999 999 ctx neighborhood:881 coexpression:663 experimental:629 database:900
Rv3009c gatB aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B 999 999 ctx neighborhood:578 cooccurence:774 coexpression:646 experimental:629 database:900 textmining:616
Rv3010c pfkA 6-phosphofructokinase 688 676 ctx neighborhood:662
Rv2572c aspS aspartate--tRNA ligase 771 639 experimental:405
Rv3013 hyp hypothetical protein 639 639 ctx neighborhood:637
Rv2992c gltS glutamate--tRNA ligase 716 601 experimental:549
Rv2029c pfkB 6-phosphofructokinase PfkB 517 516 coexpression:514
Rv3014c ligA DNA ligase A 510 510 coexpression:428
Rv1307 atpH ATP synthase subunit b/delta 505 506 coexpression:489
Rv1407 fmu 16S rRNA m5C967 methyltransferase 460 460 coexpression:419
Rv0018c pstP phosphoserine/threonine phosphatase PstP 459 459 coexpression:407
Rv1380 pyrB aspartate carbamoyltransferase 454 455 coexpression:437
Rv2727c miaA tRNA delta(2)-isopentenylpyrophosphate transferase 447 446 ctx fusion:444
Rv1385 pyrF orotidine 5'-phosphate decarboxylase 444 445 coexpression:426
Rv2150c ftsZ cell division protein FtsZ 439 440 coexpression:440

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glutamyl-tRNA(GLN) amidotransferase subunit A
  • MTBC0 PGAP product: Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA
  • Pfam (hmmscan --cut_ga): Amidase PF01425.27 (E=1e-161)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217527.2)
  • Domains: Pfam-A via hmmscan --cut_ga — Amidase (PF01425.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0154
  • Curated reference: UniProt P9WQA1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 50 functional partner(s); context anchor gatC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003200|Rv3011c|gatA
MTDIIRSDAATLAAKIAIKEVSSAEITRACLDQIEATDETYHAFLHVAADEALAAAAAVDKQVAAGEPLPSALAGVPLALKDVFTTSDMPTTCGSKILEGWRSPYDATLTARLRAAGIPILGKTNMDEFAMGSSTENSAYGPTRNPWNLDRVPGGSGGGSAAALAAFQAPLAIGSDTGGSIRQPAALTATVGVKPTYGTVSRYGLVACASSLDQGGPCARTVLDTALLHQVIAGHDPRDSTSVDAEVPDVVGAARAGAVGDLRGVRVGVVRQLHGGEGYQPGVLASFEAAVEQLTALGAEVSEVDCPHFDHALAAYYLILPSEVSSNLARFDAMRYGLRVGDDGTRSAEEVMAMTRAAGFGPEVKRRIMIGTYALSAGYYDAYYNQAQKVRTLIARDLDAAYRSVDVLVSPTTPTTAFRLGEKVDDPLAMYLFDLCTLPLNLAGHCGMSVPSGLSPDDGLPVGLQIMAPALADDRLYRVGAAYEAARGPLLSAI