Rv3008 Family assigned · low auto-curated

H37Rv Rv3008 · MTBC0 mtbc0_003197 · 207 aa · 3387953–3388576 (+) · RefSeq NP_217524.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationMgtC/SapB family protein
Revised (this work)MgtC/SapB family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YEY1 TrEMBL · unreviewed · Predicted
UniProt nameMgtC/SapB family protein

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.225 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3007c (oxidoreductase), medium confidence from genomic context alone (score 532 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1624c membrane protein 687 657 coexpression:646
Rv3007c oxidoreductase 532 532 ctx neighborhood:514
Rv0425c ctpH metal cation transporting ATPase H 554 527 coexpression:421
Rv1997 ctpF cation transporter ATPase F 546 519 coexpression:411
Rv0908 ctpE metal cation transporter ATPase E 546 518 coexpression:410
Rv0107c ctpI cation-transporter ATPase I 543 515 coexpression:407
Rv3432c gadB glutamate decarboxylase GadB 436 413 coexpression:413
Rv1901 cinA competence damage-inducible protein CinA 400 187
Rv3596c clpC1 ATP-dependent protease ATP-binding subunit ClpC 482 115 textmining:440
Rv3601c panD aspartate 1-decarboxylase 525 69 textmining:511
Rv1630 rpsA 30S ribosomal protein S1 471 69 textmining:456
Rv1667c Rv1667c, (MTV047.03c), len: 217 aa. Probable second part of macrolide-transport ATP-binding protein ABC transporter (see citation below), wi 872 61 textmining:870
Rv0191 MFS-type transporter 871 54 textmining:870
Rv3756c proZ glycine betaine/carnitine/choline/L-proline ABC transporter permease ProZ 809 44 textmining:809

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: MgtC/SapB family protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217524.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt I6YEY1 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor Rv3007c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003197|Rv3008|
MLTVVAVIGILECGLVLHMPDNDLWYCGPWTLWVMAGRGVASGAGVWRGDRVATPLAVAITAAGLVSGARIGPGAAAKRDPQLAQWNEIRSHYQEIAEWIDHDTATAHPAVAATQISAAGSFGRANMVDYLGLLDSRADETVRRDEFSRWLSAKPDYLVTTEQSVDAATIALPEFRHAYDRAATIGTLNVYRRNSPDGDEPLPADGN