cysD Family assigned · medium auto-curated

H37Rv Rv1285 · MTBC0 mtbc0_001375 · 332 aa · 1446892–1447890 (+) · RefSeq NP_215801.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)sulfate adenylyltransferase subunit 2
MTBC0 PGAP re-annotationsulfate adenylyltransferase subunit CysD
Revised (this work)Sulfate adenylyltransferase subunit CysD. Pfam: PAPS_reduct (PF01507.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIK1 SwissProt · reviewed · Evidence at protein level
UniProt nameSulfate adenylyltransferase subunit 2
EC (curated) EC 2.7.7.4
Curated functionWith CysN forms the ATP sulfurylase (ATPS) that catalyzes the adenylation of sulfate producing adenosine 5'-phosphosulfate (APS) and diphosphate, the first enzymatic step in sulfur assimilation pathway. APS synthesis involves the formation of a high-energy phosphoric-sulfuric acid anhydride bond driven by GTP hydrolysis by CysN coupled to ATP hydrolysis by CysD.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namecysD
eggNOG descriptionSulfate adenylyltransferase subunit 2
Orthologous groupCOG0175
EC number EC 2.7.7.4
KEGG orthology K00957
KEGG pathways map00230, map00261, map00450, map00920, map01100, map01120, map01130
KEGG modules M00176, M00596
Gene Ontology (42) GO:0000103, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006790, GO:0006950, GO:0006979, GO:0007154, GO:0008150, GO:0008152 +30 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.656 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PAPS_reductPF01507.26 5.3e-4763–285 Phosphoadenosine phosphosulfate reductase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cysC (adenylyl-sulfate kinase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1286 cysC adenylyl-sulfate kinase 999 1000 ctx neighborhood:881 cooccurence:774 coexpression:998 experimental:999 database:900 textmining:947
Rv2399c cysT sulfate ABC transporter permease CysT 974 972 coexpression:675 database:900
Rv2400c subI sulfate ABC transporter substrate-binding lipoprotein SubI 982 966 coexpression:657 database:900 textmining:496
Rv2398c cysW sulfate ABC transporter permease CysW 976 966 coexpression:656 database:900
Rv2397c cysA1 sulfate ABC transporter ATP-binding protein CysA 970 950 coexpression:506 database:900 textmining:432
Rv2131c cysQ 3'(2'),5'-bisphosphate nucleotidase CysQ 940 930 database:900
Rv2837c nrnA bifunctional oligoribonuclease/PAP phosphatase NrnA 902 903 database:900
Rv2613c AP-4-A phosphorylase 902 903 database:900
Rv2391 sirA sulfite reductase 953 888 ctx cooccurence:606 coexpression:660 textmining:602
Rv2847c cysG multifunctional uroporphyrin-III C-methyltransferase/precorrin-2 oxidase/ferrochelatase 906 861 coexpression:808
Rv1287 HTH-type transcriptional regulator 861 852 ctx neighborhood:807
Rv2392 cysH phosphoadenosine phosphosulfate reductase 934 749 ctx cooccurence:688 textmining:748
Rv2064 cobG precorrin-3B synthase 698 670 coexpression:659
Rv0511 hemD uroporphyrin-III C-methyltransferase 691 572 coexpression:512
Rv1284 canA beta-carbonic anhydrase 586 565 ctx neighborhood:548

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: sulfate adenylyltransferase subunit 2
  • MTBC0 PGAP product: sulfate adenylyltransferase subunit CysD
  • Pfam (hmmscan --cut_ga): PAPS_reduct PF01507.26 (E=5e-47)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215801.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PAPS_reduct (PF01507.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0175
  • Curated reference: UniProt P9WIK1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s); context anchor cysC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001375|Rv1285|cysD
MAITINMVNPTGFIRYEDVEQEAMTSDVTVGPAPGQYQLSHLRLLEAEAIHVIREVAAEFERPVLLFSGGKDSIVMLHLALKAFRPGRLPFPVMHVDTGHNFDEVIATRDELVAAAGVRLVVASVQDDIDAGRVVETIPSRNPIQTVTLLRAIRENQFDAAFGGARRDEEKARAKERVFSFRDEFGQWDPKAQRPELWNLYNGRHHKGEHIRVFPLSNWTEFDIWSYIGAEQVRLPSIYFAHRRKVFQRDGMLLAVHRHMQPRADEPVFEATVRFRTVGDVTCTGCVESSASTVAEVIAETAVARLTERGATRADDRISEAGMEDRKRQGYF