cysD Family assigned · medium auto-curated
H37Rv Rv1285 · MTBC0 mtbc0_001375 ·
332 aa ·
1446892–1447890 MTBC0
(+) ·
RefSeq NP_215801.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | sulfate adenylyltransferase subunit 2 |
|---|---|
| MTBC0 PGAP re-annotation | sulfate adenylyltransferase subunit CysD |
| Revised (this work) | Sulfate adenylyltransferase subunit CysD. Pfam: PAPS_reduct (PF01507.26). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 6 publications
6 TB publications mention this gene. 6 publication(s) discuss this gene (6 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Immunogenicity and Protective Efficacy of a Multi-Antigen Mycobacterium tuberculosis Subunit Vaccine in Mice. doi:10.3390/vaccines12090997 | 2024 |
| Delta inulin-based adjuvants promote the generation of polyfunctional CD4+ T cell responses and protection against Mycobacterium tuberculosis infection. doi:10.1038/s41598-017-09119-y | 2017 |
| Mycobacterium tuberculosis components expressed during chronic infection of the lung contribute to long-term control of pulmonary tuberculosis in mice. doi:10.1038/npjvaccines.2016.12 | 2016 |
| Mycobacterium tuberculosis Rv1152 is a Novel GntR Family Transcriptional Regulator Involved in Intrinsic Vancomycin Resistance and is a Potential Vancomycin Adjuvant Target. doi:10.1038/srep28002 | 2016 |
| Crystal structures of the kinase domain of the sulfate-activating complex in Mycobacterium tuberculosis. doi:10.1371/journal.pone.0121494 | 2015 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | cysN (Rv1286, + strand) |
|---|---|
| Overlap | 1 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 1.23 (95% CI -0.92 to 4.64). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in sulfate activation pathway. First step in the sulfate activation pathway. This reaction occurs early in the reductive branch of the cysteine biosynthetic pathway [catalytic activity:ATP + sulfate = diphosphate + adenylylsulfate] |
|---|---|
| Mycobrowser EC |
2.7.7.4
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1316
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_4133
· 93.2% identity |
| M. smegmatis |
MSMEG_4979
· 86.6% identity |
| M. orygis |
RJtmp_001352
· 100.0% identity |
| M. abscessus |
MAB_4181
· 70.9% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WIK1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Sulfate adenylyltransferase subunit 2 |
| EC (curated) |
EC 2.7.7.4
|
| Curated function | With CysN forms the ATP sulfurylase (ATPS) that catalyzes the adenylation of sulfate producing adenosine 5'-phosphosulfate (APS) and diphosphate, the first enzymatic step in sulfur assimilation pathway. APS synthesis involves the formation of a high-energy phosphoric-sulfuric acid anhydride bond driven by GTP hydrolysis by CysN coupled to ATP hydrolysis by CysD. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | cysD |
| eggNOG description | Sulfate adenylyltransferase subunit 2 |
| Orthologous group | COG0175 |
| EC number |
EC 2.7.7.4
|
| KEGG orthology |
K00957
|
| KEGG pathways |
map00230, map00261, map00450, map00920, map01100, map01120, map01130
|
| KEGG modules |
M00176, M00596
|
| Gene Ontology (42) |
GO:0000103, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006790, GO:0006950, GO:0006979, GO:0007154, GO:0008150, GO:0008152 +30 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.656 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 90.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 66.5% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 16 in the ORF — 0 in the essential state, 8 growth-defect, 8 non-essential, 0 growth-advantage. Saturation 0.750, mean read count 10.25. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| altered fitness under acid stress (stress) | -5.25 | 0.0 | required |
| fitness in mouse infection, day 10 (in vivo) | -3.44 | 0.026 | required |
| fitness in mouse infection (in vivo) | +3.23 | 0.012 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 3 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 42.8 ppm · rank 1860/3519 (47.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 332 aa |
|---|---|
| Molecular weight | 37.5 kDa |
| Theoretical pI | 6.03 |
| GRAVY | -0.303 (hydrophilic) |
| Aliphatic index | 83.1 |
| Aromaticity | 0.084 |
| Instability index | 34.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PAPS_reduct | PF01507.26 | 5.3e-47 | 63–285 | Phosphoadenosine phosphosulfate reductase domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 89.7
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1zun-assembly1_A |
1.00 | 0.91 | 2.6e-24 sig | 1zun-assembly1_A Crystal Structure of a GTP-Regulated ATP Sulfurylase Heterodimer from Pseudomonas syringae |
4bwv-assembly1_B |
1.00 | 0.65 | 3.1e-09 sig | 4bwv-assembly1_B Structure of Adenosine 5-prime-phosphosulfate Reductase apr-b from Physcomitrella Patens |
5mkp-assembly1_A |
1.00 | 0.56 | 3.1e-07 sig | 5mkp-assembly1_A Non redox thiolation in transfer RNAs occuring via sulfur activation by a [4Fe-4S] cluster |
5ztb-assembly3_C |
1.00 | 0.57 | 5.2e-06 sig | 5ztb-assembly3_C Structure of Sulfurtransferase |
3fiu-assembly2_D |
1.00 | 0.60 | 1.1e-05 sig | 3fiu-assembly2_D Structure of NMN synthetase from Francisella tularensis |
Foldseek search of the AlphaFold DB model (mean pLDDT 89.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | canA (+ strand, 93 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1286 (+ strand, -1 bp gap) |
| Predicted operon |
cysD · Rv1286
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
whiB5 (activates) · Rv1287 (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: cysC (adenylyl-sulfate kinase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1286 cysC exp |
adenylyl-sulfate kinase | 999 | 1000 ctx | neighborhood:881 cooccurence:774 coexpression:998 experimental:999 database:900 textmining:947 |
Rv2399c cysT exp |
sulfate ABC transporter permease CysT | 974 | 972 | coexpression:675 database:900 |
Rv2400c subI exp |
sulfate ABC transporter substrate-binding lipoprotein SubI | 982 | 966 | coexpression:657 database:900 textmining:496 |
Rv2398c cysW exp |
sulfate ABC transporter permease CysW | 976 | 966 | coexpression:656 database:900 |
Rv2397c cysA1 exp |
sulfate ABC transporter ATP-binding protein CysA | 970 | 950 | coexpression:506 database:900 textmining:432 |
Rv2131c cysQ exp |
3'(2'),5'-bisphosphate nucleotidase CysQ | 940 | 930 | database:900 |
Rv2837c nrnA exp |
bifunctional oligoribonuclease/PAP phosphatase NrnA | 902 | 903 | database:900 |
Rv2613c exp |
AP-4-A phosphorylase | 902 | 903 | database:900 |
Rv2391 sirA |
sulfite reductase | 953 | 888 ctx | cooccurence:606 coexpression:660 textmining:602 |
Rv2847c cysG |
multifunctional uroporphyrin-III C-methyltransferase/precorrin-2 oxidase/ferrochelatase | 906 | 861 | coexpression:808 |
Rv1287 |
HTH-type transcriptional regulator | 861 | 852 ctx | neighborhood:807 |
Rv2392 cysH |
phosphoadenosine phosphosulfate reductase | 934 | 749 ctx | cooccurence:688 textmining:748 |
Rv2064 cobG |
precorrin-3B synthase | 698 | 670 | coexpression:659 |
Rv0511 hemD |
uroporphyrin-III C-methyltransferase | 691 | 572 | coexpression:512 |
Rv1284 canA |
beta-carbonic anhydrase | 586 | 565 ctx | neighborhood:548 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: sulfate adenylyltransferase subunit 2
- MTBC0 PGAP product: sulfate adenylyltransferase subunit CysD
- Pfam (hmmscan --cut_ga): PAPS_reduct PF01507.26 (E=5e-47)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215801.1)
- Domains: Pfam-A via hmmscan --cut_ga — PAPS_reduct (PF01507.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0175 - Curated reference: UniProt P9WIK1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 89.7)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
39 functional partner(s); context anchor
cysC - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001375|Rv1285|cysD MAITINMVNPTGFIRYEDVEQEAMTSDVTVGPAPGQYQLSHLRLLEAEAIHVIREVAAEFERPVLLFSGGKDSIVMLHLALKAFRPGRLPFPVMHVDTGHNFDEVIATRDELVAAAGVRLVVASVQDDIDAGRVVETIPSRNPIQTVTLLRAIRENQFDAAFGGARRDEEKARAKERVFSFRDEFGQWDPKAQRPELWNLYNGRHHKGEHIRVFPLSNWTEFDIWSYIGAEQVRLPSIYFAHRRKVFQRDGMLLAVHRHMQPRADEPVFEATVRFRTVGDVTCTGCVESSASTVAEVIAETAVARLTERGATRADDRISEAGMEDRKRQGYF
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for cysD? Email the maintainer — the message is pre-filled with this gene's details.