csm4 Resolved · high auto-curated

H37Rv Rv2820c · MTBC0 mtbc0_002998 · 302 aa · 3148021–3148929 (-) · RefSeq NP_217336.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)CRISPR type III-associated RAMP protein Csm4
MTBC0 PGAP re-annotationtype III-A CRISPR-associated RAMP protein Csm4
Revised (this work)Type III-A CRISPR-associated RAMP protein Csm4. Pfam: RAMPs (PF03787.21), Csm4_C (PF17953.7).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJF7 SwissProt · reviewed · Evidence at protein level
UniProt nameCRISPR system Cms protein Csm4
Curated functionCRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). The type III-A Csm effector complex binds crRNA and acts as a crRNA-guided RNase, DNase and cyclic oligoadenylate synthase; binding of target RNA cognate to the crRNA is required for all activiti.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namecsm4
eggNOG descriptionCRISPR-associated RAMP protein, Csm4 family
Orthologous groupCOG1567
KEGG orthology K19139

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.23 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RAMPsPF03787.21 1.2e-0485–192 RAMP superfamily
Csm4_CPF17953.7 4.1e-25209–296 CRISPR Csm4 C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: csm3 (CRISPR type III-associated RAMP protein Csm3), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2821c csm3 CRISPR type III-associated RAMP protein Csm3 999 1000 ctx neighborhood:882 cooccurence:772 coexpression:860 experimental:928 textmining:887
Rv2822c csm2 CRISPR type III-associated protein Csm2 999 1000 ctx neighborhood:882 cooccurence:774 coexpression:826 experimental:911 textmining:852
Rv2819c csm5 CRISPR type III-associated RAMP protein Csm5 999 1000 ctx neighborhood:801 fusion:448 cooccurence:774 coexpression:847 experimental:911 textmining:857
Rv2823c cas10 CRISPR-associated protein Cas10/Csm1 999 998 ctx neighborhood:882 cooccurence:774 experimental:928 textmining:829
Rv2824c cas6 CRISPR-associated endoribonuclease Cas6 990 953 ctx neighborhood:793 cooccurence:772 textmining:804
Rv2818c csm6 CRISPR-associated protein Csm6 988 916 ctx neighborhood:587 coexpression:806 textmining:870
Rv2816c cas2 CRISPR-associated endoribonuclease Cas2 925 859 ctx neighborhood:559 cooccurence:694 textmining:491
Rv2817c cas1 CRISPR-associated endonuclease Cas1 777 777 ctx neighborhood:559 cooccurence:512
Rv1004c membrane protein 738 738 ctx cooccurence:737
Rv0355c PPE8 PPE family protein PPE8 720 721 ctx cooccurence:719
Rv3347c PPE55 PPE family protein PPE55 710 711 ctx cooccurence:710
Rv3350c PPE56 PPE family protein PPE56 709 710 ctx cooccurence:709
Rv2209 integral membrane protein 708 708 ctx cooccurence:708
Rv1917c PPE34 PPE family protein PPE34 703 703 ctx cooccurence:703
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 702 702 ctx cooccurence:702

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: CRISPR type III-associated RAMP protein Csm4
  • MTBC0 PGAP product: type III-A CRISPR-associated RAMP protein Csm4
  • Pfam (hmmscan --cut_ga): RAMPs PF03787.21 (E=1e-04), Csm4_C PF17953.7 (E=4e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217336.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RAMPs (PF03787.21), Csm4_C (PF17953.7)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1567
  • Curated reference: UniProt P9WJF7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 78 functional partner(s); context anchor csm3
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002998|Rv2820c|csm4
MNSRLFRFDFDRTHFGDHGLESSTISCPADTLYSALCVEALRMGGQQLLGELVACSTLRLTDLLPYVGPDYLVPKPLHSVRSDGSSMQKKLAKKIGFLPAAQLGSFLDGTADLKELAARQTKIGVHAVSAKAAIHNGKKDADPYRVGYFRFELDAGLWLLATGSESELGLLTRLLKGISALGGERTSGFGAFNLTESEAPAALTPTVDAASLMTLTTSLPTDDELEAALAGATYRLVKRSGFVASSTYADMPLRKRDIYKFAAGSVFSRPFQGGILDVSLGGNHPVYSYARPLFLALPESAA