csm5 Resolved · high auto-curated

H37Rv Rv2819c · MTBC0 mtbc0_002997 · 375 aa · 3146897–3148024 (-) · RefSeq NP_217335.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)CRISPR type III-associated RAMP protein Csm5
MTBC0 PGAP re-annotationtype III-A CRISPR-associated RAMP protein Csm5
Revised (this work)Type III-A CRISPR-associated RAMP protein Csm5. Pfam: RAMPs (PF03787.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJF5 SwissProt · reviewed · Evidence at protein level
UniProt nameCRISPR system Cms protein Csm5
Curated functionCRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). The type III-A Csm effector complex binds crRNA and acts as a crRNA-guided RNase, DNase and cyclic oligoadenylate synthase; binding of target RNA cognate to the crRNA is required for all activiti.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namecsm5
eggNOG descriptionCRISPR-associated RAMP protein, Csm5 family
Orthologous groupCOG1332
KEGG orthology K19140
Gene Ontology (11) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0016020, GO:0044424, GO:0044444, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.281 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.25% of strains (361) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RAMPsPF03787.21 4.3e-0911–270 RAMP superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: csm4 (CRISPR type III-associated RAMP protein Csm4), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2820c csm4 CRISPR type III-associated RAMP protein Csm4 999 1000 ctx neighborhood:801 fusion:448 cooccurence:774 coexpression:847 experimental:911 textmining:857
Rv2821c csm3 CRISPR type III-associated RAMP protein Csm3 999 999 ctx neighborhood:801 cooccurence:728 coexpression:804 experimental:927 textmining:887
Rv2822c csm2 CRISPR type III-associated protein Csm2 999 999 ctx neighborhood:801 cooccurence:774 coexpression:806 experimental:927 textmining:852
Rv2823c cas10 CRISPR-associated protein Cas10/Csm1 999 997 ctx neighborhood:801 cooccurence:772 experimental:919 textmining:830
Rv2824c cas6 CRISPR-associated endoribonuclease Cas6 990 953 ctx neighborhood:793 cooccurence:774 textmining:803
Rv2818c csm6 CRISPR-associated protein Csm6 988 944 ctx neighborhood:625 coexpression:857 textmining:803
Rv2816c cas2 CRISPR-associated endoribonuclease Cas2 920 851 ctx neighborhood:559 cooccurence:675 textmining:489
Rv0355c PPE8 PPE family protein PPE8 776 776 ctx cooccurence:773
Rv3350c PPE56 PPE family protein PPE56 782 774 ctx cooccurence:773
Rv0304c PPE5 PPE family protein PPE5 782 774 ctx cooccurence:771
Rv3347c PPE55 PPE family protein PPE55 782 774 ctx cooccurence:773
Rv1004c membrane protein 773 774 ctx cooccurence:773
Rv1917c PPE34 PPE family protein PPE34 773 773 ctx cooccurence:772
Rv3343c PPE54 PPE family protein PPE54 780 772 ctx cooccurence:771
Rv2209 integral membrane protein 772 772 ctx cooccurence:772

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: CRISPR type III-associated RAMP protein Csm5
  • MTBC0 PGAP product: type III-A CRISPR-associated RAMP protein Csm5
  • Pfam (hmmscan --cut_ga): RAMPs PF03787.21 (E=4e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217335.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RAMPs (PF03787.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1332
  • Curated reference: UniProt P9WJF5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 122 functional partner(s); context anchor csm4
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002997|Rv2819c|csm5
MNTYLKPFELTLRCLGPVFIGSGEKRTSKEYHVEGDRVYFPDMELLYADIPAHKRKSFEAFVMNTDGAQATAPLKEWVEPNAVKLDPAKHRGYEVKIGSIEPRRASRGRGGRMTRKKLTLNEIHAFIKDPLGRPYVPGSTVKGMLRSIYLQSLVHKRTAQPVRVPGHQTREHRQYGERFERKELRKSGRPNTRPQDAVNDLFQAIRVTDSPALRTSDLLICQKMDMNVHGKPDGLPLFRECLAPGTSISHRVVVDTSPTARGGWREGERFLETLAETAASVNQARYAEYRAMYPGVNAIVGPIVYLGGGAGYRSKTFVTDQDDMAKVLDAQFGKVVKHVDKTRELRVSPLVLKRTKIDNICYEMGQCELSIRRAE