Rv0078A Family assigned · medium auto-curated
H37Rv Rv0078A · MTBC0 - ·
197 aa · 87208–87801 (-) ·
RefSeq YP_177616.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains AbiEii (PF08843.18) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
L7N686
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Nucleotidyl transferase AbiEii/AbiGii toxin family protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Nucleotidyl transferase AbiEii toxin, Type IV TA system |
| Orthologous group | 2CYNV |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.7 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
AbiEii | PF08843.18 | 1.4e-09 | 17–174 | Nucleotidyl transferase AbiEii toxin, Type IV TA system |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0078B hyp |
hypothetical protein | 984 | 882 ctx | neighborhood:882 textmining:870 |
Rv0080 hyp |
hypothetical protein | 530 | 530 ctx | neighborhood:528 |
Rv0079 hyp |
hypothetical protein | 651 | 529 ctx | neighborhood:528 |
Rv3641c fic |
cell filamentation protein Fic | 806 | 59 | textmining:803 |
Rv0569 hyp |
hypothetical protein | 439 | 53 | textmining:432 |
Rv2514c hyp |
hypothetical protein | 769 | 51 | textmining:767 |
Rv2827c hyp |
hypothetical protein | 806 | 50 | textmining:805 |
Rv0229c vapC51 hyp |
hypothetical protein | 804 | 50 | textmining:803 |
Rv0207c hyp |
hypothetical protein | 552 | 50 | textmining:548 |
Rv0208c trmB |
tRNA (guanine-N(7)-)-methyltransferase | 568 | 49 | textmining:565 |
Rv0836c hyp |
hypothetical protein | 804 | 47 | textmining:803 |
Rv0268c hyp |
hypothetical protein | 804 | 47 | textmining:803 |
Rv0367c hyp |
hypothetical protein | 648 | 47 | textmining:646 |
Rv0366c hyp |
hypothetical protein | 545 | 47 | textmining:543 |
Rv2016 hyp |
hypothetical protein | 441 | 47 | textmining:438 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): AbiEii PF08843.18 (E=1e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177616.1)
- Domains: Pfam-A via hmmscan --cut_ga — AbiEii (PF08843.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2CYNV - Curated reference: UniProt L7N686 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0078A| MNAVESTLRRVAKDLTGLRQRWALVGGFAVSARSEPRFTRDVDIVVAVANDDAAESLVRQLLTQQYHLLASVEQDAARRLAAVRLGATADTAANVVVDLLFASCGIEPEIAEAAEEIEILPDLVAPVATTAHLIAMKLLARDDDRRPQDRSDLRALVDAASPQDIQDARKAIELITLRGFHRDRDLAAEWTRLAAKW