Rv0078A Family assigned · medium auto-curated

H37Rv Rv0078A · MTBC0 - · 197 aa · 87208–87801 (-) · RefSeq YP_177616.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains AbiEii (PF08843.18) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N686 TrEMBL · unreviewed · Evidence at protein level
UniProt nameNucleotidyl transferase AbiEii/AbiGii toxin family protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionNucleotidyl transferase AbiEii toxin, Type IV TA system
Orthologous group2CYNV

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.7 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AbiEiiPF08843.18 1.4e-0917–174 Nucleotidyl transferase AbiEii toxin, Type IV TA system

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv0078B hyp hypothetical protein 984 882 ctx neighborhood:882 textmining:870
Rv0080 hyp hypothetical protein 530 530 ctx neighborhood:528
Rv0079 hyp hypothetical protein 651 529 ctx neighborhood:528
Rv3641c fic cell filamentation protein Fic 806 59 textmining:803
Rv0569 hyp hypothetical protein 439 53 textmining:432
Rv2514c hyp hypothetical protein 769 51 textmining:767
Rv2827c hyp hypothetical protein 806 50 textmining:805
Rv0229c vapC51 hyp hypothetical protein 804 50 textmining:803
Rv0207c hyp hypothetical protein 552 50 textmining:548
Rv0208c trmB tRNA (guanine-N(7)-)-methyltransferase 568 49 textmining:565
Rv0836c hyp hypothetical protein 804 47 textmining:803
Rv0268c hyp hypothetical protein 804 47 textmining:803
Rv0367c hyp hypothetical protein 648 47 textmining:646
Rv0366c hyp hypothetical protein 545 47 textmining:543
Rv2016 hyp hypothetical protein 441 47 textmining:438

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): AbiEii PF08843.18 (E=1e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177616.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AbiEii (PF08843.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2CYNV
  • Curated reference: UniProt L7N686 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0078A|
MNAVESTLRRVAKDLTGLRQRWALVGGFAVSARSEPRFTRDVDIVVAVANDDAAESLVRQLLTQQYHLLASVEQDAARRLAAVRLGATADTAANVVVDLLFASCGIEPEIAEAAEEIEILPDLVAPVATTAHLIAMKLLARDDDRRPQDRSDLRALVDAASPQDIQDARKAIELITLRGFHRDRDLAAEWTRLAAKW