Rv2828A Still unknown · low auto-curated
H37Rv Rv2828A · MTBC0 - ·
89 aa ·
3136330–3136599 H37Rv
(-) ·
RefSeq YP_007411535.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF2277. Function unknown. Foldseek best (non-significant) hit: 5wi4-assembly1_C CRYSTAL STRUCTURE OF DYNLT1/TCTEX-1 IN COMPLEX WITH A (prob 0.20, TM 0.63). |
| Functional category (TubercuList) | conserved hypotheticals |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) never studied
No TB publication mentions this locus tag in its title or abstract (sweep of a ~330k-abstract PubMed TB corpus). This gene is genuinely unstudied: its darkness reflects absence of investigation, not failure of investigation.
An antigen status or a virulence phenotype is NOT a molecular function: the verdict stays unchanged. This layer adds the missing context, it does not requalify the gene. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep of title+abstract: the H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 29% of residues (metapredict) · mean AlphaFold pLDDT 91.3 |
|---|---|
| Disordered regions | 1 IDR(s), longest 26 aa [63-89] |
carries a substantial disordered region (26/89 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | Rv2828c (Rv2828c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Binding-pocket screen (P2Rank, geometric prediction) detector blind at this length
| Pockets found | 0 |
|---|---|
| Model length screened | 89 aa |
Read with care. This protein (89 aa) is below the size where this detector has meaningful power: on proven enzymes, only 3.8% (1/26) under 200 aa reach the P2Rank confidence threshold, versus 60.5% (75/124) above it (P16.3b calibration, negative control EsxA/EsxB-scale panel). A negative or weak pocket result here should NOT be read as evidence against a ligand-binding role -- the test essentially has no power at this length, not that the protein lacks a site. P16.3e, calibration phase72b_pocket_calibration.py, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -0.48 (95% CI -11.88 to 13.24). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2852A
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_1906
· 88.8% identity |
| M. smegmatis |
MSMEG_2642
· 76.7% identity |
| M. orygis |
RJtmp_002916
· 100.0% identity |
| M. abscessus |
MAB_3121c
· 76.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
I6YAC9
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | DUF2277 domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Uncharacterized conserved protein (DUF2277) |
| Orthologous group | COG5552 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.406 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.046
· 13 consensus substitution(s) under purifying selection vs M. canettii (deep divergence; dN/dS=0.046) — a real, constrained gene predating the MTBC clonal expansion |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 46/53 (87%) · mean identity 85.0%
· 3/4 closest MTBAP relatives conserved across the genus (present in 46/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 5/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 74.6% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | Uncertain · uncertain |
|---|---|
| What the call means | uncertain (short or TA-poor ORF): no call possible |
| TA sites (Himar1) | 1 in the ORF — 0 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 80. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Statistically thin call: only 1 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 4 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 9.69 ppm · rank 2699/3519 (23.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 89 aa |
|---|---|
| Molecular weight | 9.5 kDa |
| Theoretical pI | 11.1 |
| GRAVY | -0.23 (hydrophilic) |
| Aliphatic index | 85.7 |
| Aromaticity | 0.022 |
| Instability index | 67.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF2277 | PF10041.15 | 1.5e-33 | 1–84 | Uncharacterized conserved protein (DUF2277) |
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 81.7 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
5wi4-assembly1_C |
0.20 | 0.63 | 5.9e+00 | 5wi4-assembly1_C CRYSTAL STRUCTURE OF DYNLT1/TCTEX-1 IN COMPLEX WITH ARHGEF2 |
8glv-assembly1_AR |
0.18 | 0.52 | 3.9e+00 | 8glv-assembly1_AR 96-nm repeat unit of doublet microtubules from Chlamydomonas reinhardtii flagella |
5wi4-assembly1_A |
0.18 | 0.64 | 6.6e+00 | 5wi4-assembly1_A CRYSTAL STRUCTURE OF DYNLT1/TCTEX-1 IN COMPLEX WITH ARHGEF2 |
5wi4-assembly1_B |
0.16 | 0.63 | 7.0e+00 | 5wi4-assembly1_B CRYSTAL STRUCTURE OF DYNLT1/TCTEX-1 IN COMPLEX WITH ARHGEF2 |
8bqs-assembly1_Eh |
0.16 | 0.66 | 8.8e+00 | 8bqs-assembly1_Eh Cryo-EM structure of the I-II-III2-IV2 respiratory supercomplex from Tetrahymena thermophila |
8glv-assembly1_MK |
0.15 | 0.62 | 7.4e+00 | 8glv-assembly1_MK 96-nm repeat unit of doublet microtubules from Chlamydomonas reinhardtii flagella |
3g80-assembly1_A |
0.11 | 0.40 | 6.2e+00 | 3g80-assembly1_A Nodamura virus protein b2, RNA-binding domain |
2ctw-assembly1_A |
0.09 | 0.41 | 5.6e+00 | 2ctw-assembly1_A Solution structure of J-domain from mouse DnaJ subfamily C menber 5 |
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | Rv2828c (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | vapC22 (- strand, 20 bp gap) |
| Predicted operon |
Rv2828c · Rv2828A · vapC22 · vapB22
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: vapB22 (antitoxin VapB22), high confidence from genomic context alone (score 787 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2828c hyp |
hypothetical protein | 802 | 801 ctx | neighborhood:801 |
Rv2830c vapB22 |
antitoxin VapB22 | 786 | 787 ctx | neighborhood:787 |
Rv2829c vapC22 |
ribonuclease VapC22 | 786 | 787 ctx | neighborhood:787 |
Rv2831 echA16 |
enoyl-CoA hydratase EchA16 | 772 | 772 ctx | neighborhood:772 |
Rv3731 ligC |
DNA ligase C | 657 | 657 ctx | cooccurence:657 |
Rv1156 hyp |
hypothetical protein | 615 | 615 ctx | cooccurence:615 |
Rv2570 hyp |
hypothetical protein | 478 | 478 ctx | cooccurence:478 |
Rv0269c hyp |
hypothetical protein | 465 | 465 ctx | cooccurence:464 |
Rv3730c ligD hyp |
hypothetical protein | 456 | 456 ctx | cooccurence:455 |
Rv0938 ligD |
multifunctional non-homologous end joining DNA repair protein/ATP dependent DNA ligase LigD | 431 | 431 ctx | cooccurence:431 |
Rv2826c hyp |
hypothetical protein | 424 | 424 ctx | neighborhood:424 |
Rv2827c hyp |
hypothetical protein | 424 | 424 ctx | neighborhood:424 |
Rv0421c hyp |
hypothetical protein | 411 | 411 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): DUF2277 PF10041.15 (E=2e-33)
- Foldseek best: 5wi4-assembly1_C CRYSTAL STRUCTURE OF DYNLT1/TCTEX-1 IN COMPLEX WITH ARHGEF2 (prob 0.20, E=6e+00, TM=0.63)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007411535.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF2277 (PF10041.15)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG5552 - Curated reference: UniProt I6YAC9 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 81.7, confident)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
13 functional partner(s); context anchor
vapB22 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2828A| MCRNITELRGLQPPATPVEIAAAARQYVRKVSGITHPSAATAEAFEAAVAEVTATTTRLLDALPPRRQPPKTVPPLRRPDVAARLAGSR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv2828A? Email the maintainer — the message is pre-filled with this gene's details.