Rv2828A Still unknown · low auto-curated

H37Rv Rv2828A · MTBC0 - · 89 aa · 3136330–3136599 (-) · RefSeq YP_007411535.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF2277. Function unknown. Foldseek best (non-significant) hit: 5wi4-assembly1_C CRYSTAL STRUCTURE OF DYNLT1/TCTEX-1 IN COMPLEX WITH A (prob 0.20, TM 0.63).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6YAC9 TrEMBL · unreviewed · Predicted
UniProt nameDUF2277 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionUncharacterized conserved protein (DUF2277)
Orthologous groupCOG5552

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.406 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF2277PF10041.15 1.5e-331–84 Uncharacterized conserved protein (DUF2277)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 81.7 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
5wi4-assembly1_C 0.20 0.63 5.9e+00 5wi4-assembly1_C CRYSTAL STRUCTURE OF DYNLT1/TCTEX-1 IN COMPLEX WITH ARHGEF2
8glv-assembly1_AR 0.18 0.52 3.9e+00 8glv-assembly1_AR 96-nm repeat unit of doublet microtubules from Chlamydomonas reinhardtii flagella
5wi4-assembly1_A 0.18 0.64 6.6e+00 5wi4-assembly1_A CRYSTAL STRUCTURE OF DYNLT1/TCTEX-1 IN COMPLEX WITH ARHGEF2
5wi4-assembly1_B 0.16 0.63 7.0e+00 5wi4-assembly1_B CRYSTAL STRUCTURE OF DYNLT1/TCTEX-1 IN COMPLEX WITH ARHGEF2
8bqs-assembly1_Eh 0.16 0.66 8.8e+00 8bqs-assembly1_Eh Cryo-EM structure of the I-II-III2-IV2 respiratory supercomplex from Tetrahymena thermophila
8glv-assembly1_MK 0.15 0.62 7.4e+00 8glv-assembly1_MK 96-nm repeat unit of doublet microtubules from Chlamydomonas reinhardtii flagella
3g80-assembly1_A 0.11 0.40 6.2e+00 3g80-assembly1_A Nodamura virus protein b2, RNA-binding domain
2ctw-assembly1_A 0.09 0.41 5.6e+00 2ctw-assembly1_A Solution structure of J-domain from mouse DnaJ subfamily C menber 5

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapB22 (antitoxin VapB22), high confidence from genomic context alone (score 787 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2828c hyp hypothetical protein 802 801 ctx neighborhood:801
Rv2830c vapB22 antitoxin VapB22 786 787 ctx neighborhood:787
Rv2829c vapC22 ribonuclease VapC22 786 787 ctx neighborhood:787
Rv2831 echA16 enoyl-CoA hydratase EchA16 772 772 ctx neighborhood:772
Rv3731 ligC DNA ligase C 657 657 ctx cooccurence:657
Rv1156 hyp hypothetical protein 615 615 ctx cooccurence:615
Rv2570 hyp hypothetical protein 478 478 ctx cooccurence:478
Rv0269c hyp hypothetical protein 465 465 ctx cooccurence:464
Rv3730c ligD hyp hypothetical protein 456 456 ctx cooccurence:455
Rv0938 ligD multifunctional non-homologous end joining DNA repair protein/ATP dependent DNA ligase LigD 431 431 ctx cooccurence:431
Rv2826c hyp hypothetical protein 424 424 ctx neighborhood:424
Rv2827c hyp hypothetical protein 424 424 ctx neighborhood:424
Rv0421c hyp hypothetical protein 411 411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF2277 PF10041.15 (E=2e-33)
  • Foldseek best: 5wi4-assembly1_C CRYSTAL STRUCTURE OF DYNLT1/TCTEX-1 IN COMPLEX WITH ARHGEF2 (prob 0.20, E=6e+00, TM=0.63)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007411535.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF2277 (PF10041.15)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5552
  • Curated reference: UniProt I6YAC9 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 81.7, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor vapB22
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2828A|
MCRNITELRGLQPPATPVEIAAAARQYVRKVSGITHPSAATAEAFEAAVAEVTATTTRLLDALPPRRQPPKTVPPLRRPDVAARLAGSR