Rv0221 Family assigned · medium auto-curated

H37Rv Rv0221 · MTBC0 mtbc0_000235 · 469 aa · 264448–265857 (+) · RefSeq NP_214735.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)diacyglycerol O-acyltransferase
MTBC0 PGAP re-annotationwax ester/triacylglycerol synthase family O-acyltransferase
Revised (this work)Wax ester/triacylglycerol synthase family O-acyltransferase. Pfam: WS_DGAT_cat (PF03007.22), WS_DGAT_C (PF06974.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKB7 SwissProt · reviewed · Evidence at protein level
UniProt namePutative diacyglycerol O-acyltransferase Rv0221
EC (curated) EC 2.3.1.20
Curated functionCatalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for storage lipid synthesis..; FUNCTION: Upon expression in E.coli functions weakly as a triacylglycerol synthase, making triacylglycerol (TG) from diolein and long-chain fatty acyl-CoA. Has very weak wax synthase activity, incorporating palmityl alcohol into wax esters in the presence of palmitoyl-CoA.

UniProt still lists this protein as Putative diacyglycerol O-acyltransferase Rv0221; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionBelongs to the long-chain O-acyltransferase family
Orthologous groupCOG1020
EC number EC 2.3.1.20
KEGG orthology K00635
KEGG pathways map00561, map01100
KEGG modules M00089
Gene Ontology (60) GO:0000302, GO:0001666, GO:0003674, GO:0003824, GO:0004144, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006629, GO:0006638, GO:0006639 +48 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.538 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 8 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 17.65% of strains (25634) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WS_DGAT_catPF03007.22 1.7e-884–263 Wax ester synthase/diacylglycerol acyltransferase catalytic domain
WS_DGAT_CPF06974.19 3.0e-30302–449 WS/DGAT C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: echA1 (enoyl-CoA hydratase EchA1), high confidence from genomic context alone (score 963 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0222 echA1 enoyl-CoA hydratase EchA1 963 963 ctx neighborhood:836 coexpression:759
Rv3097c lipY triacylglycerol lipase Lip 900 901 database:900
Rv2252 dagK diacylglycerol kinase 900 900 database:900
Rv0220 lipC esterase LipC 908 845 ctx neighborhood:818 textmining:431
Rv3233c Rv3233c, (MTCY20B11.08c), len: 196 aa. Possible triacylglycerol synthase (See Daniel et al., 2004), similar to C-terminus of Q9RIU8|SCM11.13 887 771 ctx cooccurence:768 textmining:530
Rv0218 transmembrane protein 662 662 ctx neighborhood:659
Rv0219 transmembrane protein 634 634 ctx neighborhood:634
Rv3391 acrA1 acyl-CoA-reductase AcrA 820 605 ctx cooccurence:580 textmining:565
Rv2627c hyp hypothetical protein 579 564
Rv0547c oxidoreductase 526 527 ctx cooccurence:515
Rv0646c lipG lipase/esterase LipG 516 517 ctx cooccurence:512
Rv2048c pks12 polyketide synthase 541 514 experimental:441
Rv0217c lipW esterase LipW 822 513 ctx neighborhood:513 textmining:651
Rv2940c mas multifunctional mycocerosic acid synthase 530 503 experimental:441
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 529 501 experimental:441

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: diacyglycerol O-acyltransferase
  • MTBC0 PGAP product: wax ester/triacylglycerol synthase family O-acyltransferase
  • Pfam (hmmscan --cut_ga): WS_DGAT_cat PF03007.22 (E=2e-88), WS_DGAT_C PF06974.19 (E=3e-30)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214735.1)
  • Domains: Pfam-A via hmmscan --cut_ga — WS_DGAT_cat (PF03007.22), WS_DGAT_C (PF06974.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1020
  • Curated reference: UniProt P9WKB7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 53 functional partner(s); context anchor echA1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000235|Rv0221|
MKRLSGWDAVLLYSETPNVHMHTLKVAVIELDSDRQEFGVDAFREVIAGRLHKLEPLGYQLVDVPLKFHHPMWREHCQVDLNYHIRPWRLRAPGGRRELDEAVGEIASTPLNRDHPLWEMYFVEGLANHRIAVVAKIHHALADGVASANMMARGMDLLPGPEVGRYVPDPAPTKRQLLSAAFIDHLRHLGRIPATIRYTTQGLGRVRRSSRKLSPALTMPFTPPPTFMNHRLTPERRFATATLALIDVKATAKLLGATINDMVLAMSTGALRTLLLRYDGKAEPLLASVPVSYDFSPERISGNRFTGMLVALPADSDDPLQRVRVCHENAVSAKESHQLLGPELISRWAAYWPPAGAEALFRWLSERDGQNKVLNLNISNVPGPRERGRVGAALVTEIYSVGPLTAGSGLNITVWSYVDQLNISVLTDGSTVQDPHEVTAGMIADFIEIRRAAGLSVELTVVESAMAQA