Rv0221 Family assigned · medium auto-curated
H37Rv Rv0221 · MTBC0 mtbc0_000235 ·
469 aa · 264448–265857 (+) ·
RefSeq NP_214735.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | diacyglycerol O-acyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | wax ester/triacylglycerol synthase family O-acyltransferase |
| Revised (this work) | Wax ester/triacylglycerol synthase family O-acyltransferase. Pfam: WS_DGAT_cat (PF03007.22), WS_DGAT_C (PF06974.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WKB7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative diacyglycerol O-acyltransferase Rv0221 |
| EC (curated) |
EC 2.3.1.20
|
| Curated function | Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for storage lipid synthesis..; FUNCTION: Upon expression in E.coli functions weakly as a triacylglycerol synthase, making triacylglycerol (TG) from diolein and long-chain fatty acyl-CoA. Has very weak wax synthase activity, incorporating palmityl alcohol into wax esters in the presence of palmitoyl-CoA. |
UniProt still lists this protein as Putative diacyglycerol O-acyltransferase Rv0221; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | Belongs to the long-chain O-acyltransferase family |
| Orthologous group | COG1020 |
| EC number |
EC 2.3.1.20
|
| KEGG orthology |
K00635
|
| KEGG pathways |
map00561, map01100
|
| KEGG modules |
M00089
|
| Gene Ontology (60) |
GO:0000302, GO:0001666, GO:0003674, GO:0003824, GO:0004144, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006629, GO:0006638, GO:0006639 +48 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.538 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 8 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 17.65% of strains (25634) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
WS_DGAT_cat | PF03007.22 | 1.7e-88 | 4–263 | Wax ester synthase/diacylglycerol acyltransferase catalytic domain |
WS_DGAT_C | PF06974.19 | 3.0e-30 | 302–449 | WS/DGAT C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: echA1 (enoyl-CoA hydratase EchA1), high confidence from genomic context alone (score 963 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0222 echA1 |
enoyl-CoA hydratase EchA1 | 963 | 963 ctx | neighborhood:836 coexpression:759 |
Rv3097c lipY |
triacylglycerol lipase Lip | 900 | 901 | database:900 |
Rv2252 dagK |
diacylglycerol kinase | 900 | 900 | database:900 |
Rv0220 lipC |
esterase LipC | 908 | 845 ctx | neighborhood:818 textmining:431 |
Rv3233c |
Rv3233c, (MTCY20B11.08c), len: 196 aa. Possible triacylglycerol synthase (See Daniel et al., 2004), similar to C-terminus of Q9RIU8|SCM11.13 | 887 | 771 ctx | cooccurence:768 textmining:530 |
Rv0218 |
transmembrane protein | 662 | 662 ctx | neighborhood:659 |
Rv0219 |
transmembrane protein | 634 | 634 ctx | neighborhood:634 |
Rv3391 acrA1 |
acyl-CoA-reductase AcrA | 820 | 605 ctx | cooccurence:580 textmining:565 |
Rv2627c hyp |
hypothetical protein | 579 | 564 | |
Rv0547c |
oxidoreductase | 526 | 527 ctx | cooccurence:515 |
Rv0646c lipG |
lipase/esterase LipG | 516 | 517 ctx | cooccurence:512 |
Rv2048c pks12 |
polyketide synthase | 541 | 514 | experimental:441 |
Rv0217c lipW |
esterase LipW | 822 | 513 ctx | neighborhood:513 textmining:651 |
Rv2940c mas |
multifunctional mycocerosic acid synthase | 530 | 503 | experimental:441 |
Rv2933 ppsC |
phthiocerol synthesis polyketide synthase type I PpsC | 529 | 501 | experimental:441 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: diacyglycerol O-acyltransferase
- MTBC0 PGAP product: wax ester/triacylglycerol synthase family O-acyltransferase
- Pfam (hmmscan --cut_ga): WS_DGAT_cat PF03007.22 (E=2e-88), WS_DGAT_C PF06974.19 (E=3e-30)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214735.1)
- Domains: Pfam-A via hmmscan --cut_ga — WS_DGAT_cat (PF03007.22), WS_DGAT_C (PF06974.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1020 - Curated reference: UniProt P9WKB7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
53 functional partner(s); context anchor
echA1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000235|Rv0221| MKRLSGWDAVLLYSETPNVHMHTLKVAVIELDSDRQEFGVDAFREVIAGRLHKLEPLGYQLVDVPLKFHHPMWREHCQVDLNYHIRPWRLRAPGGRRELDEAVGEIASTPLNRDHPLWEMYFVEGLANHRIAVVAKIHHALADGVASANMMARGMDLLPGPEVGRYVPDPAPTKRQLLSAAFIDHLRHLGRIPATIRYTTQGLGRVRRSSRKLSPALTMPFTPPPTFMNHRLTPERRFATATLALIDVKATAKLLGATINDMVLAMSTGALRTLLLRYDGKAEPLLASVPVSYDFSPERISGNRFTGMLVALPADSDDPLQRVRVCHENAVSAKESHQLLGPELISRWAAYWPPAGAEALFRWLSERDGQNKVLNLNISNVPGPRERGRVGAALVTEIYSVGPLTAGSGLNITVWSYVDQLNISVLTDGSTVQDPHEVTAGMIADFIEIRRAAGLSVELTVVESAMAQA