Rv2765 Family assigned · medium auto-curated
H37Rv Rv2765 · MTBC0 mtbc0_002943 ·
245 aa · 3097051–3097788 (+) ·
RefSeq NP_217281.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hydrolase |
|---|---|
| MTBC0 PGAP re-annotation | dienelactone hydrolase family protein |
| Revised (this work) | Dienelactone hydrolase family protein. Pfam: DLH (PF01738.25). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6XF92
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable alanine rich hydrolase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| eggNOG description | dienelactone hydrolase |
| Orthologous group | COG0412 |
| EC number |
EC 3.1.1.45
|
| KEGG orthology |
K01061
|
| KEGG pathways |
map00361, map00364, map00623, map01100, map01110, map01120, map01130
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.577 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 7 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DLH | PF01738.25 | 9.1e-69 | 17–243 | Dienelactone hydrolase family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: dfrA (dihydrofolate reductase), high confidence from genomic context alone (score 713 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2054 hyp |
hypothetical protein | 925 | 926 | database:900 |
Rv2763c dfrA |
dihydrofolate reductase | 713 | 713 ctx | neighborhood:713 |
Rv2762c hyp |
hypothetical protein | 673 | 673 ctx | neighborhood:673 |
Rv3192 hyp |
hypothetical protein | 582 | 582 ctx | neighborhood:512 |
Rv2764c thyA |
thymidylate synthase ThyA | 725 | 533 ctx | neighborhood:532 textmining:435 |
Rv1832 gcvB |
glycine dehydrogenase | 441 | 441 | coexpression:422 |
Rv2761c hsdS |
type I restriction/modification system specificity determinant HsdS | 533 | 371 | |
Rv2755c hsdS.1 |
Rv2755c, (MTV002.20c), len: 91 aa. Possible hsdS.1,fragment of type I restriction/modification system specificity determinant (S protein), s | 670 | 302 | textmining:546 |
Rv2754c thyX |
thymidylate synthase ThyX | 484 | 214 | |
Rv3254 hyp |
hypothetical protein | 719 | 198 | textmining:664 |
Rv3366 spoU |
tRNA/rRNA methylase SpoU | 662 | 73 | textmining:651 |
Rv1781c malQ |
4-alpha-glucanotransferase | 517 | 55 | textmining:510 |
Rv0724A |
Conserved hypothetical protein; Rv0724A, len: 111 aa. Similarity suggests that this CDS should be continuation of Rv0725c but we can find no | 661 | 54 | textmining:657 |
Rv3304 hyp |
hypothetical protein | 444 | 49 | textmining:440 |
Rv3253c |
cationic amino acid transport integral membrane protein | 514 | 47 | textmining:511 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hydrolase
- MTBC0 PGAP product: dienelactone hydrolase family protein
- Pfam (hmmscan --cut_ga): DLH PF01738.25 (E=9e-69)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217281.1)
- Domains: Pfam-A via hmmscan --cut_ga — DLH (PF01738.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0412 - Curated reference: UniProt I6XF92 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
dfrA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002943|Rv2765| MPKTTDTAATPDGTCAVRLFTPDGPGRWPGVVMFPDAGGVRDTFDRMAAKLAGFGYVVLLPDVYYREGDWAPFDMKTAFGDPQERARIMFMIGTLTPDRVTRDADALLNYLASRPEVIGDRFGVCGYCMGGRMSVVVAGRLPDRVAAAAAFHPGGLVANSPDSPHLLADRISATVYIGGAENDPSFTADHAEKLDKAFSAAGVPHRIECYPAAHGFAVPDNPSYDAAADERHWAAMTETFGAALN