Rv2765 Family assigned · medium auto-curated
H37Rv Rv2765 · MTBC0 mtbc0_002943 ·
245 aa ·
3097051–3097788 MTBC0
(+) ·
RefSeq NP_217281.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hydrolase |
|---|---|
| MTBC0 PGAP re-annotation | dienelactone hydrolase family protein |
| Revised (this work) | Dienelactone hydrolase family protein. Pfam: DLH (PF01738.25). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 1 publication
1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Mutations of Mycobacterium tuberculosis induced by anti-tuberculosis treatment result in metabolism changes and elevation of ethambutol resistance. doi:10.1016/j.meegid.2018.09.027 | 2019 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 1.25 (95% CI -0.43 to 4.26). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown; probably involved in cellular metabolism. |
|---|---|
| Mycobrowser EC |
3.1.1.45
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2787
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_1955
· 73.1% identity |
| M. smegmatis |
MSMEG_2669
· 60.2% identity |
| M. orygis |
RJtmp_002852
· 100.0% identity |
| M. abscessus |
MAB_3183c
· 54.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
I6XF92
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable alanine rich hydrolase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| eggNOG description | dienelactone hydrolase |
| Orthologous group | COG0412 |
| EC number |
EC 3.1.1.45
|
| KEGG orthology |
K01061
|
| KEGG pathways |
map00361, map00364, map00623, map01100, map01110, map01120, map01130
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.577 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 7 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.331 (low power)
· 4 consensus substitution(s) low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 72.0%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 5/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 39.8% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 15 in the ORF — 0 in the essential state, 0 growth-defect, 15 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 93.4666666667. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 351.0 ppm · rank 570/3519 (83.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 245 aa |
|---|---|
| Molecular weight | 26.2 kDa |
| Theoretical pI | 5.06 |
| GRAVY | -0.117 (hydrophilic) |
| Aliphatic index | 68.7 |
| Aromaticity | 0.098 |
| Instability index | 31.1 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DLH | PF01738.25 | 9.1e-69 | 17–243 | Dienelactone hydrolase family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4zv9-assembly5_E |
1.00 | 0.85 | 2.6e-17 sig | 4zv9-assembly5_E 2.00 Angstrom resolution crystal structure of an uncharacterized protein from Escherichia coli O157:H7 str. Sakai |
1zix-assembly1_A |
1.00 | 0.87 | 6.7e-17 sig | 1zix-assembly1_A Crystal Structure Analysis of the dienelactone hydrolase mutant (E36D, R105H, C123S, G211D, K234N)- 1.8 A |
1din-assembly1_A |
1.00 | 0.87 | 8.6e-17 sig | 1din-assembly1_A DIENELACTONE HYDROLASE AT 2.8 ANGSTROMS |
1zi9-assembly1_A |
1.00 | 0.87 | 1.7e-16 sig | 1zi9-assembly1_A Crystal Structure Analysis of the dienelactone hydrolase (E36D, C123S) mutant- 1.5 A |
4u2f-assembly1_A |
1.00 | 0.87 | 1.6e-16 sig | 4u2f-assembly1_A Crystal structure of dienelactone hydrolase B-1 variant (Q35H, F38L, Y64H, Q110L, C123S, Y137C, Y145C, N154D, E199G, S208G and G211D) at 1.80 A resolution |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Catalytic-site verification (M-CSA on the structural model) fold only
| M-CSA entry | 492 · EC 3.1.1.45 |
|---|---|
| Catalytic residues | 3/7 identical (7/7 aligned) |
| Verdict | FOLD-ONLY (3/7 identical although 7/7 aligned: catalytic residues SUBSTITUTED) -> same fold, active site NOT retained |
Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | thyA (- strand, 164 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2766c (- strand, 214 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv1353c (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: dfrA (dihydrofolate reductase), high confidence from genomic context alone (score 713 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2054 hyp exp |
hypothetical protein | 925 | 926 | database:900 |
Rv2763c dfrA |
dihydrofolate reductase | 713 | 713 ctx | neighborhood:713 |
Rv2762c hyp |
hypothetical protein | 673 | 673 ctx | neighborhood:673 |
Rv3192 hyp |
hypothetical protein | 582 | 582 ctx | neighborhood:512 |
Rv2764c thyA |
thymidylate synthase ThyA | 725 | 533 ctx | neighborhood:532 textmining:435 |
Rv1832 gcvB |
glycine dehydrogenase | 441 | 441 | coexpression:422 |
Rv2761c hsdS |
type I restriction/modification system specificity determinant HsdS | 533 | 371 | |
Rv2755c hsdS.1 |
Rv2755c, (MTV002.20c), len: 91 aa. Possible hsdS.1,fragment of type I restriction/modification system specificity determinant (S protein), s | 670 | 302 | textmining:546 |
Rv2754c thyX |
thymidylate synthase ThyX | 484 | 214 | |
Rv3254 hyp |
hypothetical protein | 719 | 198 | textmining:664 |
Rv3366 spoU |
tRNA/rRNA methylase SpoU | 662 | 73 | textmining:651 |
Rv1781c malQ |
4-alpha-glucanotransferase | 517 | 55 | textmining:510 |
Rv0724A |
Conserved hypothetical protein; Rv0724A, len: 111 aa. Similarity suggests that this CDS should be continuation of Rv0725c but we can find no | 661 | 54 | textmining:657 |
Rv3304 hyp |
hypothetical protein | 444 | 49 | textmining:440 |
Rv3253c |
cationic amino acid transport integral membrane protein | 514 | 47 | textmining:511 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hydrolase
- MTBC0 PGAP product: dienelactone hydrolase family protein
- Pfam (hmmscan --cut_ga): DLH PF01738.25 (E=9e-69)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217281.1)
- Domains: Pfam-A via hmmscan --cut_ga — DLH (PF01738.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0412 - Curated reference: UniProt I6XF92 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.5)
- Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 492; catalytic residues aligned onto the structural model
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
dfrA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002943|Rv2765| MPKTTDTAATPDGTCAVRLFTPDGPGRWPGVVMFPDAGGVRDTFDRMAAKLAGFGYVVLLPDVYYREGDWAPFDMKTAFGDPQERARIMFMIGTLTPDRVTRDADALLNYLASRPEVIGDRFGVCGYCMGGRMSVVVAGRLPDRVAAAAAFHPGGLVANSPDSPHLLADRISATVYIGGAENDPSFTADHAEKLDKAFSAAGVPHRIECYPAAHGFAVPDNPSYDAAADERHWAAMTETFGAALN
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv2765? Email the maintainer — the message is pre-filled with this gene's details.