darT Resolved · high
H37Rv Rv0059 · MTBC0 mtbc0_000064 ·
230 aa ·
63308–64000 MTBC0
(+) ·
RefSeq NP_214573.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | toxin-antitoxin system toxin DarT |
| Revised (this work) | DarT (DarT_Mtb), toxin of the DarTG toxin-antitoxin system: a DNA ADP-ribosyltransferase that sequence-specifically modifies thymidines on single-stranded DNA. Unchecked it blocks replication and is bactericidal; it is neutralised and reversed by the cognate antitoxin DarG (Rv0060). The toxin is dispensable for viability. |
| Functional category (TubercuList) | conserved hypotheticals |
In the literature (TB corpus sweep) 2 publications
Found under: H37Rv (2).
2 TB publications mention this gene. 2 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.
| Publication | Date |
|---|---|
| Depletion of the DarG antitoxin in Mycobacterium tuberculosis triggers the DNA-damage response and leads to cell death. doi:10.1111/mmi.14571 | 2020 |
| Identification of novel mutations associated with cycloserine resistance in Mycobacterium tuberculosis. doi:10.1093/jac/dkx316 | 2017 |
This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
WhiB4 (whiB4).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.14 (95% CI -3.39 to 4.44). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser) ahead of Mycobrowser
Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (curated function (UniProt), EC number, COG category, requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0060
· 100.0% identity |
|---|---|
| M. orygis |
RJtmp_000064
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53604
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | DNA ADP-ribosyl transferase |
| EC (curated) |
EC 2.4.2.-
|
| Curated function | Toxic component of the hybrid type II/IV toxin-antitoxin (TA) system DarTG, which plays a crucial role in controlling bacterial growth and bacteriophage infection. Its toxic effect is neutralized by cognate antitoxin DarG. ADP-ribosylates ssDNA, preferentially in the motif TTTW. In case of phage infection, DarT toxin ADP-ribosylates DNA, which inhibits both viral DNA and RNA synthesis and leads to abortive infection (By similarity). Uncontrolled expression of DarT leads to ADP-ribosylation of the origin of chromosomal replication DNA in cells (in vitro the most heavily modified motifs are TTTT. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| eggNOG description | Domain of unknown function (DUF4433) |
| Orthologous group | COG4948 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.397 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 5 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.19% of strains (283) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) MTBC-specific
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 0/53 (0%)
· 0/4 closest MTBAP relatives SENSITIVITY DOWNGRADE: a divergent homolog is detectable at relaxed thresholds (weak hit 51%/30%cov in M_syngnathidarum — likely present but divergent); NOT a robust MTBC-specific innovation — present but divergent. The strict tblastn absence was a coverage/identity-threshold artefact. |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria absent from the whole genus and from all outgroups tested — a candidate MTBC-specific innovation (confirm by synteny; rule out detection failure for short/divergent ORFs) |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | GA · growth-advantage |
|---|---|
| What the call means | growth-advantage: insertions enriched |
| TA sites (Himar1) | 21 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 21 growth-advantage. Saturation 1.000, mean read count 262.428571429. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 9 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 41.4 ppm · rank 1879/3519 (46.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 230 aa |
|---|---|
| Molecular weight | 25.6 kDa |
| Theoretical pI | 8.24 |
| GRAVY | -0.235 (hydrophilic) |
| Aliphatic index | 78.8 |
| Aromaticity | 0.104 |
| Instability index | 42.5 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DarT | PF14487.13 | 6.6e-61 | 29–230 | ssDNA thymidine ADP-ribosyltransferase, DarT |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
7yk3 |
X-ray diffraction | 2.2 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7yk3-assembly2_C |
1.00 | 0.98 | 4.7e-43 sig | 7yk3-assembly2_C Crystal structure of DarTG toxin-antitoxin complex from Mycobacterium tuberculosis |
7on0-assembly1_AAA |
1.00 | 0.90 | 4.1e-18 sig | 7on0-assembly1_AAA Thermus sp. 2.9 DarT in complex with ADP-ribosylated ssDNA |
7omw-assembly1_AAA |
1.00 | 0.90 | 1.4e-16 sig | 7omw-assembly1_AAA Thermus sp. 2.9 DarT in complex with NAD+ |
7omx-assembly1_AAA |
1.00 | 0.91 | 3.0e-16 sig | 7omx-assembly1_AAA Thermus sp. 2.9 DarT in complex with carba-NAD+ |
7omu-assembly2_BBB |
1.00 | 0.72 | 1.1e-09 sig | 7omu-assembly2_BBB Thermosipho africanus DarTG in complex with ADP-ribose |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | dnaB (+ strand, 179 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0060 (+ strand, 16 bp gap) |
| Predicted operon |
Rv0059 · Rv0060
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv0047c (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: dnaB (replicative DNA helicase), high confidence from genomic context alone (score 857 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0060 darG hyp |
hypothetical protein | 989 | 947 ctx | neighborhood:763 cooccurence:771 textmining:807 |
Rv0058 dnaB |
replicative DNA helicase | 856 | 857 ctx | neighborhood:485 coexpression:733 |
Rv0355c PPE8 |
PPE family protein PPE8 | 624 | 625 ctx | cooccurence:621 |
Rv1452c PE_PGRS28 |
PE-PGRS family protein PE_PGRS28 | 623 | 624 ctx | cooccurence:623 |
Rv0341 iniB |
isoniazid inducible protein IniB | 622 | 623 ctx | cooccurence:622 |
Rv2490c PE_PGRS43 |
PE-PGRS family protein PE_PGRS43 | 616 | 617 ctx | cooccurence:616 |
Rv1525 wbbL2 |
rhamnosyl transferase WbbL | 615 | 615 ctx | cooccurence:610 |
Rv3347c PPE55 |
PPE family protein PPE55 | 613 | 613 ctx | cooccurence:611 |
Rv3350c PPE56 |
PPE family protein PPE56 | 610 | 610 ctx | cooccurence:608 |
Rv1917c PPE34 |
PPE family protein PPE34 | 605 | 606 ctx | cooccurence:600 |
Rv2209 |
integral membrane protein | 613 | 600 ctx | cooccurence:598 |
Rv0304c PPE5 |
PPE family protein PPE5 | 589 | 589 ctx | cooccurence:585 |
Rv3879c espK |
ESX-1 secretion-associated protein EspK | 580 | 581 ctx | cooccurence:580 |
Rv1004c |
membrane protein | 561 | 561 ctx | cooccurence:561 |
Rv3343c PPE54 |
PPE family protein PPE54 | 561 | 561 ctx | cooccurence:557 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- MTBC0 PGAP product: 'toxin-antitoxin system toxin DarT'
- Pfam (hmmscan --cut_ga): DarT PF14487 (E=6.6e-61), the DarT/DUF4433 ADP-ribosyltransferase domain
- Operon partner of Rv0060 (DarG, macrodomain) -- a complete DarTG module
ESM Atlas signal (exploratory)
Ancestral protein hash 7f8cb4b7850195d36c7a3c3b2e23ee1c ·
10 ESM-space neighbours (max similarity 0.957).
SAE features are orienting indices, not validated domains.
| # | Index | Activation | Interpretation |
|---|---|---|---|
| 1 | 1600 |
1.21 | Active site-adjacent loops/hinges |
| 2 | 9906 |
1.03 | ADP-ribosyltransferase/NADase catalytic core |
| 3 | 8638 |
0.97 | ART/PARP NAD+-binding catalytic cleft |
| 4 | 12356 |
0.90 | ADP-ribosyltransferase/NADase catalytic core |
| 5 | 12685 |
0.88 | ADP-ribosyltransferase catalytic core |
| 6 | 13107 |
0.77 | Noncatalytic loop-helix caps |
| 7 | 11478 |
0.71 | Interfacial alpha-helical scaffold signature |
| 8 | 3297 |
0.66 | ADP-ribose processing active sites |
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214573.1)
- Domains: Pfam-A via hmmscan --cut_ga — DarT (PF14487.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4948 - Curated reference: UniProt O53604 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
74 functional partner(s); context anchor
dnaB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: Jankevicius G, Ariza A, Ahel M, Ahel I (2016). The Toxin-Antitoxin System DarTG Catalyzes Reversible ADP-Ribosylation of DNA Molecular Cell. doi:10.1016/j.molcel.2016.11.014 PMID:27939941
Ancestral MTBC0 protein sequence
>mtbc0_000064|Rv0059|darT MITRYKPESGFVARSGGPDRKRPHDWIVWHFTHADNLPGIITAGRLLADSAVTPTTEVAYNPVKELRRHKVVAPDSRYPASMASDHVPFYIAARSPMLYVVCKGHSGYSGGAGPLVHLGVALGDIIDADLTWCASDGNAAASYTKFSRQVDTLGTFVDFDLLCQRQWHNTDDDPNRQSRRAAEILVYGHVPFELVSYVCCYNTETMTRVRTLLDPVGGVRKYVIKPGMYY
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for darT? Email the maintainer — the message is pre-filled with this gene's details.