darT Resolved · high

H37Rv Rv0059 · MTBC0 mtbc0_000064 · 230 aa · 63308–64000 MTBC0 (+) · RefSeq NP_214573.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationtoxin-antitoxin system toxin DarT
Revised (this work)DarT (DarT_Mtb), toxin of the DarTG toxin-antitoxin system: a DNA ADP-ribosyltransferase that sequence-specifically modifies thymidines on single-stranded DNA. Unchecked it blocks replication and is bactericidal; it is neutralised and reversed by the cognate antitoxin DarG (Rv0060). The toxin is dispensable for viability.
Functional category (TubercuList)conserved hypotheticals

In the literature (TB corpus sweep) 2 publications

Found under: H37Rv (2).

2 TB publications mention this gene. 2 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.

PublicationDate
Depletion of the DarG antitoxin in Mycobacterium tuberculosis triggers the DNA-damage response and leads to cell death. doi:10.1111/mmi.14571 2020
Identification of novel mutations associated with cycloserine resistance in Mycobacterium tuberculosis. doi:10.1093/jac/dkx316 2017

This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): WhiB4 (whiB4).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 0.14 (95% CI -3.39 to 4.44). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser) ahead of Mycobrowser

Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (curated function (UniProt), EC number, COG category, requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0060 · 100.0% identity
M. orygis RJtmp_000064 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O53604 SwissProt · reviewed · Evidence at protein level
UniProt nameDNA ADP-ribosyl transferase
EC (curated) EC 2.4.2.-
Curated functionToxic component of the hybrid type II/IV toxin-antitoxin (TA) system DarTG, which plays a crucial role in controlling bacterial growth and bacteriophage infection. Its toxic effect is neutralized by cognate antitoxin DarG. ADP-ribosylates ssDNA, preferentially in the motif TTTW. In case of phage infection, DarT toxin ADP-ribosylates DNA, which inhibits both viral DNA and RNA synthesis and leads to abortive infection (By similarity). Uncontrolled expression of DarT leads to ADP-ribosylation of the origin of chromosomal replication DNA in cells (in vitro the most heavily modified motifs are TTTT.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
eggNOG descriptionDomain of unknown function (DUF4433)
Orthologous groupCOG4948

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.397 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 5 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.19% of strains (283) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) MTBC-specific

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 0/53 (0%) · 0/4 closest MTBAP relatives
SENSITIVITY DOWNGRADE: a divergent homolog is detectable at relaxed thresholds (weak hit 51%/30%cov in M_syngnathidarum — likely present but divergent); NOT a robust MTBC-specific innovation — present but divergent. The strict tblastn absence was a coverage/identity-threshold artefact.
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

absent from the whole genus and from all outgroups tested — a candidate MTBC-specific innovation (confirm by synteny; rule out detection failure for short/divergent ORFs)

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 21 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 21 growth-advantage. Saturation 1.000, mean read count 262.428571429. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 9 of 16 independent MS datasets
Integrated abundance41.4 ppm · rank 1879/3519 (46.6th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length230 aa
Molecular weight25.6 kDa
Theoretical pI8.24
GRAVY-0.235 (hydrophilic)
Aliphatic index78.8
Aromaticity0.104
Instability index42.5 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DarTPF14487.13 6.6e-6129–230 ssDNA thymidine ADP-ribosyltransferase, DarT

Experimental structures (Protein Data Bank) 1 solved

PDBMethodResolutionCoverage
7yk3 X-ray diffraction 2.2 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.3

PDB hitprobTM-scoreE-valueDescription
7yk3-assembly2_C 1.00 0.98 4.7e-43 sig 7yk3-assembly2_C Crystal structure of DarTG toxin-antitoxin complex from Mycobacterium tuberculosis
7on0-assembly1_AAA 1.00 0.90 4.1e-18 sig 7on0-assembly1_AAA Thermus sp. 2.9 DarT in complex with ADP-ribosylated ssDNA
7omw-assembly1_AAA 1.00 0.90 1.4e-16 sig 7omw-assembly1_AAA Thermus sp. 2.9 DarT in complex with NAD+
7omx-assembly1_AAA 1.00 0.91 3.0e-16 sig 7omx-assembly1_AAA Thermus sp. 2.9 DarT in complex with carba-NAD+
7omu-assembly2_BBB 1.00 0.72 1.1e-09 sig 7omu-assembly2_BBB Thermosipho africanus DarTG in complex with ADP-ribose

Foldseek search of the AlphaFold DB model (mean pLDDT 96.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)dnaB (+ strand, 179 bp gap)
Downstream (3' on genome)Rv0060 (+ strand, 16 bp gap)
Predicted operon Rv0059 · Rv0060

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) Rv0047c (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: dnaB (replicative DNA helicase), high confidence from genomic context alone (score 857 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0060 darG hyp hypothetical protein 989 947 ctx neighborhood:763 cooccurence:771 textmining:807
Rv0058 dnaB replicative DNA helicase 856 857 ctx neighborhood:485 coexpression:733
Rv0355c PPE8 PPE family protein PPE8 624 625 ctx cooccurence:621
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 623 624 ctx cooccurence:623
Rv0341 iniB isoniazid inducible protein IniB 622 623 ctx cooccurence:622
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 616 617 ctx cooccurence:616
Rv1525 wbbL2 rhamnosyl transferase WbbL 615 615 ctx cooccurence:610
Rv3347c PPE55 PPE family protein PPE55 613 613 ctx cooccurence:611
Rv3350c PPE56 PPE family protein PPE56 610 610 ctx cooccurence:608
Rv1917c PPE34 PPE family protein PPE34 605 606 ctx cooccurence:600
Rv2209 integral membrane protein 613 600 ctx cooccurence:598
Rv0304c PPE5 PPE family protein PPE5 589 589 ctx cooccurence:585
Rv3879c espK ESX-1 secretion-associated protein EspK 580 581 ctx cooccurence:580
Rv1004c membrane protein 561 561 ctx cooccurence:561
Rv3343c PPE54 PPE family protein PPE54 561 561 ctx cooccurence:557

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: 'toxin-antitoxin system toxin DarT'
  • Pfam (hmmscan --cut_ga): DarT PF14487 (E=6.6e-61), the DarT/DUF4433 ADP-ribosyltransferase domain
  • Operon partner of Rv0060 (DarG, macrodomain) -- a complete DarTG module

ESM Atlas signal (exploratory)

Ancestral protein hash 7f8cb4b7850195d36c7a3c3b2e23ee1c · 10 ESM-space neighbours (max similarity 0.957). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
11600 1.21 Active site-adjacent loops/hinges
29906 1.03 ADP-ribosyltransferase/NADase catalytic core
38638 0.97 ART/PARP NAD+-binding catalytic cleft
412356 0.90 ADP-ribosyltransferase/NADase catalytic core
512685 0.88 ADP-ribosyltransferase catalytic core
613107 0.77 Noncatalytic loop-helix caps
711478 0.71 Interfacial alpha-helical scaffold signature
83297 0.66 ADP-ribose processing active sites

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214573.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DarT (PF14487.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4948
  • Curated reference: UniProt O53604 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 74 functional partner(s); context anchor dnaB
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: Jankevicius G, Ariza A, Ahel M, Ahel I (2016). The Toxin-Antitoxin System DarTG Catalyzes Reversible ADP-Ribosylation of DNA Molecular Cell. doi:10.1016/j.molcel.2016.11.014 PMID:27939941

Ancestral MTBC0 protein sequence

>mtbc0_000064|Rv0059|darT
MITRYKPESGFVARSGGPDRKRPHDWIVWHFTHADNLPGIITAGRLLADSAVTPTTEVAYNPVKELRRHKVVAPDSRYPASMASDHVPFYIAARSPMLYVVCKGHSGYSGGAGPLVHLGVALGDIIDADLTWCASDGNAAASYTKFSRQVDTLGTFVDFDLLCQRQWHNTDDDPNRQSRRAAEILVYGHVPFELVSYVCCYNTETMTRVRTLLDPVGGVRKYVIKPGMYY