Rv1002c Resolved · high auto-curated

H37Rv Rv1002c · MTBC0 mtbc0_001077 · 503 aa · 1125764–1127275 (-) · RefSeq NP_215518.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)dolichyl-phosphate-mannose--protein mannosyltransferase
MTBC0 PGAP re-annotationdolichyl-phosphate-mannose--protein mannosyltransferase
Revised (this work)Dolichyl-phosphate-mannose--protein mannosyltransferase. Pfam: PMT_2 (PF13231.13), PMT (PF02366.25), PMT_4TMC (PF16192.11).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WN05 SwissProt · reviewed · Evidence at protein level
UniProt namePolyprenol-phosphate-mannose--protein mannosyltransferase
EC (curated) EC 2.4.1.-
Curated functionProtein O-mannosyltransferase that catalyzes the transfer of a single mannose residue from a polyprenol phospho-mannosyl lipidic donor to the hydroxyl group of selected serine and threonine residues in acceptor proteins. Sec-translocation of the acceptor proteins is required for protein mannosylation, suggesting that O-mannosylation should affect only extracytoplasmic proteins. Is crucial for virulence. It may play a role in adaptive regulation of the mannoproteome during host cell infection..; FUNCTION: Overexpression in M.smegmatis decreases the cell envelope permeability and promotes microb.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred namepmt
eggNOG descriptionDolichyl-phosphate-mannose--protein O-mannosyl transferase
Orthologous groupCOG4346
EC number EC 2.4.1.109
KEGG orthology K00728
KEGG pathways map00514, map00515, map01100
CAZy family GT39
Gene Ontology (39) GO:0000030, GO:0003674, GO:0003824, GO:0006464, GO:0006486, GO:0006493, GO:0006807, GO:0008150, GO:0008152, GO:0009058, GO:0009059, GO:0009100 +27 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.256 · purifying
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PMT_2PF13231.13 1.7e-0883–171 Dolichyl-phosphate-mannose-protein mannosyltransferase
PMTPF02366.25 5.1e-12100–281 Dolichyl-phosphate-mannose-protein mannosyltransferase
PMT_4TMCPF16192.11 1.3e-13310–502 C-terminal four TMM region of protein-O-mannosyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rsmI (rRNA small subunit methyltransferase I), high confidence from genomic context alone (score 786 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1003 rsmI rRNA small subunit methyltransferase I 786 786 ctx neighborhood:783
Rv2219 transmembrane protein 698 699 ctx cooccurence:696
Rv2413c hyp hypothetical protein 696 697 ctx cooccurence:696
Rv3311 hyp hypothetical protein 642 643 ctx cooccurence:641
Rv2146c transmembrane protein 638 638 ctx cooccurence:637
Rv2050 rbpA RNA polymerase-binding protein RbpA 635 636 ctx cooccurence:634
Rv2708c hyp hypothetical protein 634 635 ctx cooccurence:633
Rv2680 hyp hypothetical protein 631 632 ctx cooccurence:630
Rv0883c sepH hyp hypothetical protein 619 619 ctx cooccurence:617
Rv3212 hyp hypothetical protein 613 614 ctx cooccurence:610
Rv3438 hyp hypothetical protein 605 606 ctx cooccurence:600
Rv0004 hyp hypothetical protein 592 592 ctx cooccurence:592
Rv0528 transmembrane protein 579 580 ctx cooccurence:577
Rv2446c integral membrane protein 569 570 ctx cooccurence:565
Rv0813c hyp hypothetical protein 567 567 ctx cooccurence:540

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: dolichyl-phosphate-mannose--protein mannosyltransferase
  • MTBC0 PGAP product: dolichyl-phosphate-mannose--protein mannosyltransferase
  • Pfam (hmmscan --cut_ga): PMT_2 PF13231.13 (E=2e-08), PMT PF02366.25 (E=5e-12), PMT_4TMC PF16192.11 (E=1e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215518.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PMT_2 (PF13231.13), PMT (PF02366.25), PMT_4TMC (PF16192.11)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4346
  • Curated reference: UniProt P9WN05 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 66 functional partner(s); context anchor rsmI
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001077|Rv1002c|
MVPVVSPGPLVPVADFGPLDRLRGWIVTGLITLLATVTRFLNLGSLTDAGTPIFDEKHYAPQAWQVLNNHGVEDNPGYGLVVHPPVGKQLIAIGEAIFGYNGFGWRFTGALLGVVLVALVVRIVRRISRSTLVGAIAGVLLICDGVSFVTARTALLDGFLTFFVVAAFGALIVDRDQVRERMHIALLAGRSAATVWGPRVGVRWWRFGAGVLLGLACATKWSGVYFVLFFGAMALAFDVAARRQYQVQRPWLGTVRRDVLPSGYALGLIPFAVYLATYAPWFASETAIDRHAVGQAVGRNSVVPLPDAVRSLWHYTAKAFHFHAGLTNSAGNYHPWESKPWTWPMSLRPVLYAIDQQDVAGCGAQSCVKAEMLVGTPAMWWLAVPVLAYAGWRMFVRRDWRYAVVLVGYCAGWLPWFADIDRQMYFFYAATMAPFLVMGISLVLGDILYHPGQGSERRTLGLIVVCCYVALVVTNFAWLYPVLTGLPISQQTWNLEIWLPSWR