Rv1002c Resolved · high auto-curated
H37Rv Rv1002c · MTBC0 mtbc0_001077 ·
503 aa ·
1125764–1127275 MTBC0
(-) ·
RefSeq NP_215518.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | dolichyl-phosphate-mannose--protein mannosyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | dolichyl-phosphate-mannose--protein mannosyltransferase |
| Revised (this work) | Dolichyl-phosphate-mannose--protein mannosyltransferase. Pfam: PMT_2 (PF13231.13), PMT (PF02366.25), PMT_4TMC (PF16192.11). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 10 publications
10 TB publications mention this gene. 10 publication(s) discuss this gene (10 in a M. tuberculosis context, 6 in other mycobacteria — M. smegmatis (5), M. abscessus (1)).
| Publication | Date |
|---|---|
| Enhanced Glycosylation Caused by Overexpression of Rv1002c in a Recombinant BCG Promotes Immune Response and Protects against Mycobacterium tuberculosis Infection. doi:10.3390/vaccines12060622 | 2024 |
| Development of a novel target-based cell assay, reporter of the activity of Mycobacterium tuberculosis protein-O-mannosyltransferase. doi:10.1093/glycob/cwad072 | 2023 |
| Protein O-mannosyltransferase Rv1002c contributes to low cell permeability, biofilm formation in vitro, and mycobacterial survival in mice. doi:10.1111/apm.13204 | 2022 |
| Effect of Protein O-Mannosyltransferase (MSMEG_5447) on M. smegmatis and Its Survival in Macrophages. doi:10.3389/fmicb.2021.657726 | 2021 |
| Lipoprotein Glycosylation by Protein-O-Mannosyltransferase (MAB_1122c) Contributes to Low Cell Envelope Permeability and Antibiotic Resistance of Mycobacterium abscessus. doi:10.3389/fmicb.2017.02123 | 2017 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -1.23 (95% CI -1.38 to -1.09). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser EC |
2.4.-.-
· superseded EC numbering; the atlas uses the current class (2.4.1.-, 2.4.1.109)
|
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1029c
· 97.8% identity |
|---|---|
| M. leprae |
ML0192c
· 79.2% identity |
| M. marinum |
MMAR_4491
· 85.3% identity |
| M. smegmatis |
MSMEG_5447
· 75.2% identity |
| M. orygis |
RJtmp_001061
· 97.8% identity |
| M. abscessus |
MAB_1122c
· 67.9% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WN05
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Polyprenol-phosphate-mannose--protein mannosyltransferase |
| EC (curated) |
EC 2.4.1.-
|
| Curated function | Protein O-mannosyltransferase that catalyzes the transfer of a single mannose residue from a polyprenol phospho-mannosyl lipidic donor to the hydroxyl group of selected serine and threonine residues in acceptor proteins. Sec-translocation of the acceptor proteins is required for protein mannosylation, suggesting that O-mannosylation should affect only extracytoplasmic proteins. Is crucial for virulence. It may play a role in adaptive regulation of the mannoproteome during host cell infection..; FUNCTION: Overexpression in M.smegmatis decreases the cell envelope permeability and promotes microb. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
O Post-translational modification, protein turnover, chaperones
|
|---|---|
| Preferred name | pmt |
| eggNOG description | Dolichyl-phosphate-mannose--protein O-mannosyl transferase |
| Orthologous group | COG4346 |
| EC number |
EC 2.4.1.109
|
| KEGG orthology |
K00728
|
| KEGG pathways |
map00514, map00515, map01100
|
| CAZy family |
GT39
|
| Gene Ontology (39) |
GO:0000030, GO:0003674, GO:0003824, GO:0006464, GO:0006486, GO:0006493, GO:0006807, GO:0008150, GO:0008152, GO:0009058, GO:0009059, GO:0009100 +27 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.256 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 7 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 4 consensus substitution(s) low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 84.3%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 10/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 50.2% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) GD — not strictly essential
| DeJesus 2017 call | GD · growth-defect |
|---|---|
| What the call means | growth-defect: insertions tolerated but fitness reduced; NOT essential |
| TA sites (Himar1) | 24 in the ORF — 0 in the essential state, 20 growth-defect, 4 non-essential, 0 growth-advantage. Saturation 0.792, mean read count 4.47368421053. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | `essential: true` here is the broad union (ES+ESD+GD) kept for backward compatibility; this gene is NOT strictly essential. Read n_sites_* before writing anything about essentiality. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| Mutants exhibiting altered fitness in the absence of gene marP (other) | -4.77 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) | -2.82 | 0.026 | required |
| Differential genetic requirements of clinical Mtb strain (ID=630) from Euro-American lineage (compared to H37Rv control) (strain background) | -2.82 | 0.031 | required |
| fitness in mouse infection (in vivo) | +2.41 | 0.0074 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 4 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 7 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 3.85 ppm · rank 3026/3519 (14.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (11 TM helixes) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 11 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 503 aa |
|---|---|
| Molecular weight | 55.5 kDa |
| Theoretical pI | 9.39 |
| GRAVY | 0.481 (hydrophobic) |
| Aliphatic index | 106.4 |
| Aromaticity | 0.135 |
| Instability index | 41.8 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PMT_2 | PF13231.13 | 1.7e-08 | 83–171 | Dolichyl-phosphate-mannose-protein mannosyltransferase |
PMT | PF02366.25 | 5.1e-12 | 100–281 | Dolichyl-phosphate-mannose-protein mannosyltransferase |
PMT_4TMC | PF16192.11 | 1.3e-13 | 310–502 | C-terminal four TMM region of protein-O-mannosyltransferase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.9
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6p2r-assembly1_A |
1.00 | 0.70 | 1.6e-13 sig | 6p2r-assembly1_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor |
6p25-assembly1_B |
1.00 | 0.70 | 1.2e-12 sig | 6p25-assembly1_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor |
7e9s-assembly1_A |
1.00 | 0.49 | 3.5e-08 sig | 7e9s-assembly1_A Archaeal oligosaccharyltransferase AglB from Archaeoglobus fulgidus in complex with an inhibitory peptide and a dolichol-phosphate |
3wak-assembly1_A |
1.00 | 0.47 | 3.8e-08 sig | 3wak-assembly1_A Crystal structure of the Archaeoglobus fulgidus oligosaccharyltransferase (O29867_ARCFU) in the apo form |
5f15-assembly1_A |
1.00 | 0.50 | 3.2e-06 sig | 5f15-assembly1_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate |
Foldseek search of the AlphaFold DB model (mean pLDDT 91.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | arcA (+ strand, 34 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1003 (+ strand, 82 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: rsmI (rRNA small subunit methyltransferase I), high confidence from genomic context alone (score 786 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1003 rsmI |
rRNA small subunit methyltransferase I | 786 | 786 ctx | neighborhood:783 |
Rv2219 |
transmembrane protein | 698 | 699 ctx | cooccurence:696 |
Rv2413c hyp |
hypothetical protein | 696 | 697 ctx | cooccurence:696 |
Rv3311 hyp |
hypothetical protein | 642 | 643 ctx | cooccurence:641 |
Rv2146c |
transmembrane protein | 638 | 638 ctx | cooccurence:637 |
Rv2050 rbpA |
RNA polymerase-binding protein RbpA | 635 | 636 ctx | cooccurence:634 |
Rv2708c hyp |
hypothetical protein | 634 | 635 ctx | cooccurence:633 |
Rv2680 hyp |
hypothetical protein | 631 | 632 ctx | cooccurence:630 |
Rv0883c sepH hyp |
hypothetical protein | 619 | 619 ctx | cooccurence:617 |
Rv3212 hyp |
hypothetical protein | 613 | 614 ctx | cooccurence:610 |
Rv3438 hyp |
hypothetical protein | 605 | 606 ctx | cooccurence:600 |
Rv0004 hyp |
hypothetical protein | 592 | 592 ctx | cooccurence:592 |
Rv0528 |
transmembrane protein | 579 | 580 ctx | cooccurence:577 |
Rv2446c |
integral membrane protein | 569 | 570 ctx | cooccurence:565 |
Rv0813c hyp |
hypothetical protein | 567 | 567 ctx | cooccurence:540 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: dolichyl-phosphate-mannose--protein mannosyltransferase
- MTBC0 PGAP product: dolichyl-phosphate-mannose--protein mannosyltransferase
- Pfam (hmmscan --cut_ga): PMT_2 PF13231.13 (E=2e-08), PMT PF02366.25 (E=5e-12), PMT_4TMC PF16192.11 (E=1e-13)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215518.1)
- Domains: Pfam-A via hmmscan --cut_ga — PMT_2 (PF13231.13), PMT (PF02366.25), PMT_4TMC (PF16192.11)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4346 - Curated reference: UniProt P9WN05 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.9)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
66 functional partner(s); context anchor
rsmI - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001077|Rv1002c| MVPVVSPGPLVPVADFGPLDRLRGWIVTGLITLLATVTRFLNLGSLTDAGTPIFDEKHYAPQAWQVLNNHGVEDNPGYGLVVHPPVGKQLIAIGEAIFGYNGFGWRFTGALLGVVLVALVVRIVRRISRSTLVGAIAGVLLICDGVSFVTARTALLDGFLTFFVVAAFGALIVDRDQVRERMHIALLAGRSAATVWGPRVGVRWWRFGAGVLLGLACATKWSGVYFVLFFGAMALAFDVAARRQYQVQRPWLGTVRRDVLPSGYALGLIPFAVYLATYAPWFASETAIDRHAVGQAVGRNSVVPLPDAVRSLWHYTAKAFHFHAGLTNSAGNYHPWESKPWTWPMSLRPVLYAIDQQDVAGCGAQSCVKAEMLVGTPAMWWLAVPVLAYAGWRMFVRRDWRYAVVLVGYCAGWLPWFADIDRQMYFFYAATMAPFLVMGISLVLGDILYHPGQGSERRTLGLIVVCCYVALVVTNFAWLYPVLTGLPISQQTWNLEIWLPSWR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv1002c? Email the maintainer — the message is pre-filled with this gene's details.