Rv2644c Still unknown · low auto-curated
H37Rv Rv2644c · MTBC0 - ·
105 aa · 2968533–2968850 (-) ·
RefSeq NP_217160.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 3azo-assembly2_B Crystal structure of puromycin hydrolase (prob 0.14, TM 0.69). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WL53
SwissProt · reviewed
· Predicted
|
|---|---|
| UniProt name | Uncharacterized protein Rv2644c |
UniProt still lists this protein as Uncharacterized protein Rv2644c; the revised annotation above is ahead of the current UniProt record.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 36.1 (very low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
3azo-assembly2_B |
0.14 | 0.69 | 4.5e+00 | 3azo-assembly2_B Crystal structure of puromycin hydrolase |
3o4g-assembly1_B |
0.11 | 0.60 | 3.7e+00 | 3o4g-assembly1_B Structure and Catalysis of Acylaminoacyl Peptidase |
5my7-assembly1_A |
0.10 | 0.56 | 3.4e+00 | 5my7-assembly1_A Adhesin Complex Protein from Neisseria meningitidis |
6lxi-assembly2_B |
0.07 | 0.53 | 5.4e+00 | 6lxi-assembly2_B Crystal structure of Z2B3 Fab in complex with influenza virus neuraminidase from A/Brevig Mission/1/1918 (H1N1) |
3o4h-assembly1_B |
0.07 | 0.59 | 7.0e+00 | 3o4h-assembly1_B Structure and Catalysis of Acylaminoacyl Peptidase |
6zgp-assembly4_K |
0.06 | 0.49 | 3.2e+00 | 6zgp-assembly4_K Crystal structure of the quaternary ammonium Rieske monooxygenase CntA in complex with inhibitor MMV12 (MMV020670) |
4re6-assembly1_B |
0.05 | 0.58 | 9.7e+00 | 4re6-assembly1_B Acylaminoacyl peptidase complexed with a chloromethylketone inhibitor |
9har-assembly1_EV |
0.04 | 0.55 | 9.1e+00 | 9har-assembly1_EV pT=3 virus-like particle of ssRNA phage ESE017 coat protein |
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Foldseek best: 3azo-assembly2_B Crystal structure of puromycin hydrolase (prob 0.14, E=4e+00, TM=0.69)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217160.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Curated reference: UniProt P9WL53 (SwissProt, reviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 36.1, very low)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2644c| MSPRRTSGGVVPVDRYRIDEGLIVVLVFAGRDERRRTVCFADKFGCVHIGNPDLYRPQTSLPQPLPISSHAISGSRFVETTNRADQQEPIGPNRAELFDQALHAG