Rv2644c Still unknown · low auto-curated

H37Rv Rv2644c · MTBC0 - · 105 aa · 2968533–2968850 (-) · RefSeq NP_217160.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 3azo-assembly2_B Crystal structure of puromycin hydrolase (prob 0.14, TM 0.69).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WL53 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv2644c

UniProt still lists this protein as Uncharacterized protein Rv2644c; the revised annotation above is ahead of the current UniProt record.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 36.1 (very low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
3azo-assembly2_B 0.14 0.69 4.5e+00 3azo-assembly2_B Crystal structure of puromycin hydrolase
3o4g-assembly1_B 0.11 0.60 3.7e+00 3o4g-assembly1_B Structure and Catalysis of Acylaminoacyl Peptidase
5my7-assembly1_A 0.10 0.56 3.4e+00 5my7-assembly1_A Adhesin Complex Protein from Neisseria meningitidis
6lxi-assembly2_B 0.07 0.53 5.4e+00 6lxi-assembly2_B Crystal structure of Z2B3 Fab in complex with influenza virus neuraminidase from A/Brevig Mission/1/1918 (H1N1)
3o4h-assembly1_B 0.07 0.59 7.0e+00 3o4h-assembly1_B Structure and Catalysis of Acylaminoacyl Peptidase
6zgp-assembly4_K 0.06 0.49 3.2e+00 6zgp-assembly4_K Crystal structure of the quaternary ammonium Rieske monooxygenase CntA in complex with inhibitor MMV12 (MMV020670)
4re6-assembly1_B 0.05 0.58 9.7e+00 4re6-assembly1_B Acylaminoacyl peptidase complexed with a chloromethylketone inhibitor
9har-assembly1_EV 0.04 0.55 9.1e+00 9har-assembly1_EV pT=3 virus-like particle of ssRNA phage ESE017 coat protein

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Foldseek best: 3azo-assembly2_B Crystal structure of puromycin hydrolase (prob 0.14, E=4e+00, TM=0.69)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217160.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt P9WL53 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 36.1, very low)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2644c|
MSPRRTSGGVVPVDRYRIDEGLIVVLVFAGRDERRRTVCFADKFGCVHIGNPDLYRPQTSLPQPLPISSHAISGSRFVETTNRADQQEPIGPNRAELFDQALHAG