Rv0828c Resolved · high auto-curated

H37Rv Rv0828c · MTBC0 - · 140 aa · 921191–921613 (-) · RefSeq NP_215343.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)deaminase
MTBC0 PGAP re-annotation
Revised (this work)Deaminase. Pfam: dCMP_cyt_deam_1 (PF00383.30), MafB19-deam (PF14437.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O53839 TrEMBL · unreviewed · Predicted
UniProt namePossible deaminase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
J Translation, ribosomal structure and biogenesis
Preferred nameguaD
eggNOG descriptionMafB19-like deaminase
Orthologous groupCOG0590
EC number EC 3.5.4.3
KEGG orthology K01487
KEGG pathways map00230, map01100

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.315 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
dCMP_cyt_deam_1PF00383.30 7.7e-127–68 Cytidine and deoxycytidylate deaminase zinc-binding region
MafB19-deamPF14437.13 3.3e-0813–69 MafB19-like deaminase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0830 (S-adenosylmethionine-dependent methyltransferase), high confidence from genomic context alone (score 700 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0830 S-adenosylmethionine-dependent methyltransferase 700 700 ctx neighborhood:699
Rv0827c kmtR HTH-type transcriptional regulator KmtR 675 675 ctx neighborhood:675
Rv2122c hisE phosphoribosyl-ATP pyrophosphatase 640 627 coexpression:627
Rv0427c xthA exodeoxyribonuclease III protein XthA 642 622 database:610
Rv0829 Rv0829, (MTV043.21), len: 96 aa. Possible transposase for IS1605' (fragment), similar to C-terminal end of many mycobacterial transposases a 583 582 ctx neighborhood:581
Rv0120c fusA2 elongation factor G 551 551 database:550
Rv0684 fusA1 elongation factor G 550 551 database:550
Rv3279c birA bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase 453 454 coexpression:435
Rv3086 adhD alcohol dehydrogenase D 428 428 coexpression:410
Rv0162c adhE1 zinc-type alcohol dehydrogenase subunit E 427 427 coexpression:409
Rv0761c adhB alcohol dehydrogenase B 426 427 coexpression:408
Rv2259 mscR S-nitrosomycothiol reductase MscR 426 427 coexpression:408
Rv3262 fbiB coenzyme F420:L-glutamate ligase 425 425 coexpression:406
Rv3421c tsaB hyp hypothetical protein 471 424 coexpression:404
Rv2641 cadI cadmium inducible protein CadI 432 418 coexpression:418

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): deaminase
  • Pfam (hmmscan --cut_ga): dCMP_cyt_deam_1 PF00383.30 (E=8e-12), MafB19-deam PF14437.13 (E=3e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215343.1)
  • Domains: Pfam-A via hmmscan --cut_ga — dCMP_cyt_deam_1 (PF00383.30), MafB19-deam (PF14437.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0590
  • Curated reference: UniProt O53839 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 32 functional partner(s); context anchor Rv0830
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0828c|
MPAGMAGFRRWAQTNDPTAHAESLAIRAACTKLGTEHLVGTTLNVLAHPCPMCYGSLYYCSPDEVVFLTSRDAYEPHYVDDRRYFEPATFYDEFAKEWQDRRLPMRQEHRPDIRAGAVDVYRFRQEPNGGERSAIAAPTG