Rv0828c Resolved · high auto-curated

H37Rv Rv0828c · MTBC0 - · 140 aa · 921191–921613 H37Rv (-) · RefSeq NP_215343.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)deaminase
MTBC0 PGAP re-annotation
Revised (this work)Deaminase. Pfam: dCMP_cyt_deam_1 (PF00383.30), MafB19-deam (PF14437.13).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.71 (95% CI -0.49 to 2.60). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown; probably involved in deamination of specific substrate.
Mycobrowser EC 3.5.-.- · superseded EC numbering; the atlas uses the current class (3.5.4.3)

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0851c · 100.0% identity
M. marinum MMAR_4851 · 75.2% identity
M. orygis RJtmp_000874 · 100.0% identity
M. abscessus MAB_0053c · 70.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O53839 TrEMBL · unreviewed · Predicted
UniProt namePossible deaminase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
J Translation, ribosomal structure and biogenesis
Preferred nameguaD
eggNOG descriptionMafB19-like deaminase
Orthologous groupCOG0590
EC number EC 3.5.4.3
KEGG orthology K01487
KEGG pathways map00230, map01100

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.315 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) inf (low power) · 2 consensus substitution(s)
low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 64.4% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 8/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 42.2%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 10 in the ORF — 0 in the essential state, 0 growth-defect, 10 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 302.1. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) not detected

Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.

Physico-chemical properties (computed, ProtParam)

Length140 aa
Molecular weight15.9 kDa
Theoretical pI5.93
GRAVY-0.594 (hydrophilic)
Aliphatic index57.3
Aromaticity0.114
Instability index54.4 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
dCMP_cyt_deam_1PF00383.30 7.7e-127–68 Cytidine and deoxycytidylate deaminase zinc-binding region
MafB19-deamPF14437.13 3.3e-0813–69 MafB19-like deaminase

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 83.5

PDB hitprobTM-scoreE-valueDescription
1tiy-assembly1_A 1.00 0.85 7.3e-08 sig 1tiy-assembly1_A X-RAY STRUCTURE OF GUANINE DEAMINASE FROM BACILLUS SUBTILIS NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET SR160
2b3j-assembly2_D 1.00 0.94 4.0e-04 sig 2b3j-assembly2_D Crystal Structure of Staphylococcus aureus tRNA Adenosine Deaminase, TadA, in Complex with RNA
1wwr-assembly1_A 1.00 0.93 7.6e-04 sig 1wwr-assembly1_A Crystal structure of tRNA adenosine deaminase TadA from Aquifex aeolicus
6vpc-assembly1_E 1.00 0.87 4.0e-04 sig 6vpc-assembly1_E Structure of the SpCas9 DNA adenine base editor - ABE8e
2a8n-assembly1_A 1.00 0.88 4.2e-04 sig 2a8n-assembly1_A Biochemical and Structural Studies of A-to-I Editing by tRNA:A34 Deaminases at the Wobble Position of Transfer RNA

Foldseek search of the AlphaFold DB model (mean pLDDT 83.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)kmtR (- strand, 57 bp gap)
Downstream (3' on genome)Rv0830 (+ strand, 356 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) Rv0135c (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv0830 (S-adenosylmethionine-dependent methyltransferase), high confidence from genomic context alone (score 700 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0830 S-adenosylmethionine-dependent methyltransferase 700 700 ctx neighborhood:699
Rv0827c kmtR HTH-type transcriptional regulator KmtR 675 675 ctx neighborhood:675
Rv2122c hisE phosphoribosyl-ATP pyrophosphatase 640 627 coexpression:627
Rv0427c xthA exp exodeoxyribonuclease III protein XthA 642 622 database:610
Rv0829 Rv0829, (MTV043.21), len: 96 aa. Possible transposase for IS1605' (fragment), similar to C-terminal end of many mycobacterial transposases a 583 582 ctx neighborhood:581
Rv0120c fusA2 exp elongation factor G 551 551 database:550
Rv0684 fusA1 exp elongation factor G 550 551 database:550
Rv3279c birA bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase 453 454 coexpression:435
Rv3086 adhD alcohol dehydrogenase D 428 428 coexpression:410
Rv0162c adhE1 zinc-type alcohol dehydrogenase subunit E 427 427 coexpression:409
Rv0761c adhB alcohol dehydrogenase B 426 427 coexpression:408
Rv2259 mscR S-nitrosomycothiol reductase MscR 426 427 coexpression:408
Rv3262 fbiB coenzyme F420:L-glutamate ligase 425 425 coexpression:406
Rv3421c tsaB hyp hypothetical protein 471 424 coexpression:404
Rv2641 cadI cadmium inducible protein CadI 432 418 coexpression:418

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): deaminase
  • Pfam (hmmscan --cut_ga): dCMP_cyt_deam_1 PF00383.30 (E=8e-12), MafB19-deam PF14437.13 (E=3e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215343.1)
  • Domains: Pfam-A via hmmscan --cut_ga — dCMP_cyt_deam_1 (PF00383.30), MafB19-deam (PF14437.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0590
  • Curated reference: UniProt O53839 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 83.5)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 32 functional partner(s); context anchor Rv0830
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0828c|
MPAGMAGFRRWAQTNDPTAHAESLAIRAACTKLGTEHLVGTTLNVLAHPCPMCYGSLYYCSPDEVVFLTSRDAYEPHYVDDRRYFEPATFYDEFAKEWQDRRLPMRQEHRPDIRAGAVDVYRFRQEPNGGERSAIAAPTG