Rv3131 Resolved · medium auto-curated
H37Rv Rv3131 · MTBC0 mtbc0_003328 ·
332 aa · 3517916–3518914 (+) ·
RefSeq NP_217647.3
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | NAD(P)H nitroreductase |
|---|---|
| MTBC0 PGAP re-annotation | NAD(P)H nitroreductase |
| Revised (this work) | NAD(P)H nitroreductase. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WIZ7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative NAD(P)H nitroreductase Rv3131 |
| Curated function | Stimulates pro-inflammatory cytokine expression via TLR2 signaling pathway. Activation of TLR2 results in the phosphorylation and activation of NF-kappa-B. Also induces TLR2 expression. May influence the innate immune responses to facilitate the survival of M.tuberculosis in the granulomatous microenvironment. |
UniProt still lists this protein as Putative NAD(P)H nitroreductase Rv3131; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| eggNOG description | nitroreductase |
| Orthologous group | COG0778 |
| Gene Ontology (13) |
GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0008150, GO:0016020, GO:0040007, GO:0044424, GO:0044444, GO:0044464 +1 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.238 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: tgs1 (diacyglycerol O-acyltransferase), high confidence from genomic context alone (score 949 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3130c tgs1 |
diacyglycerol O-acyltransferase | 980 | 949 ctx | neighborhood:506 coexpression:863 textmining:626 |
Rv1738 hyp |
hypothetical protein | 937 | 915 ctx | cooccurence:419 coexpression:860 |
Rv3127 hyp |
hypothetical protein | 912 | 893 | coexpression:860 |
Rv3134c |
universal stress protein | 946 | 892 | coexpression:827 textmining:529 |
Rv1996 |
universal stress protein | 918 | 890 | coexpression:860 |
Rv2032 acg |
NAD(P)H nitroreductase | 908 | 890 | coexpression:852 |
Rv2031c hspX |
alpha-crystallin | 918 | 864 | coexpression:860 textmining:429 |
Rv0079 hyp |
hypothetical protein | 908 | 860 | coexpression:860 |
Rv2030c hyp |
hypothetical protein | 919 | 841 | coexpression:801 textmining:514 |
Rv2007c fdxA |
ferredoxin | 937 | 836 | coexpression:833 textmining:632 |
Rv1733c |
transmembrane protein | 898 | 828 | coexpression:806 textmining:433 |
Rv2626c hrp1 |
hypoxic response protein | 893 | 818 | coexpression:817 textmining:439 |
Rv0080 hyp |
hypothetical protein | 916 | 811 | coexpression:807 textmining:579 |
Rv2623 TB31.7 |
universal stress protein | 891 | 810 | coexpression:761 textmining:455 |
Rv2627c hyp |
hypothetical protein | 808 | 808 | coexpression:807 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: NAD(P)H nitroreductase
- MTBC0 PGAP product: NAD(P)H nitroreductase
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217647.3)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0778 - Curated reference: UniProt P9WIZ7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
56 functional partner(s); context anchor
tgs1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003328|Rv3131| MNTHFPDAETVRTVLTLAVRAPSIHNTQPWRWRVCPTSLELFSRPDMQLRSTDPDGRELILSCGVALHHCVVALASLGWQAKVNRFPDPKDRCHLATIGVQPLVPDQADVALAAAIPRRRTDRRAYSCWPVPGGDIALMAARAARGGVMLRQVSALDRMKAIVAQAVLDHVTDEEYLRELTIWSGRYGSVAGVPARNEPPSDPSAPIPGRLFAGPGLSQPSDVLPADDGAAILALGTETDDRLARLRAGEAASIVLLTATAMGLACCPITEPLEIAKTRDAVRAEVFGAGGYPQMLLRVGWAPINADPLPPTPRRELSQVVEWPEELLRQRC