Rv2302 Family assigned · medium

H37Rv Rv2302 · MTBC0 mtbc0_002442 · 80 aa · 2598562–2598804 (+) · RefSeq NP_216818.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF1918 domain-containing protein
Revised (this work)Conserved hypothetical protein with an NMR-determined solution structure: a five-strand antiparallel beta-sheet core with one C-terminal alpha-helix, with no high structural similarity to known proteins (a possible novel fold). Up-regulated under starvation and heat-shock; structural homolog of Rv0569. Biochemical function unknown.

Curated reference (UniProt)

UniProt P9WLD5 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2302

UniProt still lists this protein as Uncharacterized protein Rv2302; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
eggNOG descriptionDomain of unknown function (DUF1918)
Orthologous groupCOG2905
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.343 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (172) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF1918PF08940.18 2.0e-271–58 Domain of unknown function (DUF1918)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 89.9 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2a7y-assembly1_A 1.00 0.56 9.6e-08 sig 2a7y-assembly1_A Solution Structure of the Conserved Hypothetical Protein Rv2302 from the Bacterium Mycobacterium tuberculosis
5znp-assembly2_B 0.57 0.59 6.3e-01 5znp-assembly2_B Crystal structure of PtSHL in complex with an H3K4me3 peptide
6bph-assembly1_A-2 0.51 0.60 1.7e+00 6bph-assembly1_A-2 Crystal structure of the chromodomain of RBBP1
7oh3-assembly1_T 0.51 0.41 4.5e-01 7oh3-assembly1_T Nog1-TAP associated immature ribosomal particle population B from S. cerevisiae
3oby-assembly1_A 0.51 0.41 3.8e-01 3oby-assembly1_A Crystal structure of Archaeoglobus fulgidus Pelota reveals inter-domain structural plasticity
7hg5-assembly3_C 0.47 0.48 7.9e-01 7hg5-assembly3_C PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z2142244288
2f5k-assembly6_F 0.38 0.46 1.3e+00 2f5k-assembly6_F Crystal structure of the chromo domain of human MRG15
6bhe-assembly1_A 0.35 0.54 2.1e+00 6bhe-assembly1_A Crystal structure of SETDB1 with a modified H3 peptide

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cut2 (cutinase), medium confidence from genomic context alone (score 627 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2301 cut2 cutinase 627 627 ctx neighborhood:560
Rv1888c Rv1888c, (MTCY180.30), len: 186 aa. Possible transmembrane protein. 579 580 ctx cooccurence:577
Rv2557 hyp hypothetical protein 567 568 ctx cooccurence:539
Rv1738 hyp hypothetical protein 559 560 ctx cooccurence:557
Rv2558 hyp hypothetical protein 550 551 ctx cooccurence:530
Rv2551c hyp hypothetical protein 543 543 ctx cooccurence:542
Rv2632c hyp hypothetical protein 516 516 ctx cooccurence:494
Rv0080 hyp hypothetical protein 490 491 ctx cooccurence:488
Rv3131 NAD(P)H nitroreductase 481 480 ctx cooccurence:476
Rv3134c universal stress protein 458 459 ctx cooccurence:450
Rv2027c dosT two component sensor histidine kinase DosT 472 452
Rv3132c devS two component sensor histidine kinase DevS 463 442
Rv2300c metallo-hydrolase 418 418 ctx neighborhood:416
Rv3127 hyp hypothetical protein 415 413 ctx cooccurence:409
Rv1014c pth peptidyl-tRNA hydrolase 401 402

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • NMR solution structure; novel fold (no Dali match); stress-induced (Buchko 2006, PMID 16885468)
  • Structural homolog of Rv0569
  • Pfam DUF1918
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216818.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF1918 (PF08940.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2905
  • Curated reference: UniProt P9WLD5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 89.9, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 17 functional partner(s); context anchor cut2
  • Primary literature: Buchko GW, Kim CY, Terwilliger TC, Kennedy MA (2006). Solution structure of the conserved hypothetical protein Rv2302 from Mycobacterium tuberculosis J Bacteriol 188(16):5993-6001. doi:10.1128/JB.00460-06 PMID:16885468

Ancestral MTBC0 protein sequence

>mtbc0_002442|Rv2302|
MHAKVGDYLVVKGTTTERHDQHAEIIEVRSADGSPPYVVRWLVNGHETTVYPGSDAVVVTATEHAEAEKRAAARAGHAAT