Rv2631 Resolved · high auto-curated

H37Rv Rv2631 · MTBC0 - · 432 aa · 2957572–2958870 (+) · RefSeq NP_217147.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)RNA-splicing ligase RtcB
MTBC0 PGAP re-annotation
Revised (this work)RNA-splicing ligase RtcB. Pfam: RtcB (PF01139.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WGW5 SwissProt · reviewed · Evidence at transcript level
UniProt nameRNA-splicing ligase RtcB
EC (curated) EC 6.5.1.8
Curated functionGTP-dependent RNA ligase that is involved RNA repair. Joins RNA with 2',3'-cyclic-phosphate or 3'-phosphate ends to RNA with 5'-hydroxy ends.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namertcB
eggNOG descriptiontRNA-splicing ligase RtcB
Orthologous groupCOG1690
EC number EC 6.5.1.3
KEGG orthology K14415
Gene Ontology (7) GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.355 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RtcBPF01139.23 3.9e-1642–432 tRNA-splicing ligase RtcB

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv2630 hyp hypothetical protein 987 984 ctx neighborhood:754 coexpression:834 database:597
Rv2629 hyp hypothetical protein 903 904 ctx neighborhood:491 coexpression:819
Rv0570 nrdZ vitamin B12-dependent ribonucleoside-diphosphate reductase 747 746 coexpression:746
Rv3211 rhlE ATP-dependent RNA helicase RhlE 664 646 database:447
Rv1253 deaD ATP-dependent RNA helicase DeaD 663 645 database:447
Rv0571c hyp hypothetical protein 781 538 coexpression:431 textmining:546
Rv0579 hyp hypothetical protein 433 434 ctx cooccurence:424
Rv2628 hyp hypothetical protein 431 431
Rv2003c hyp hypothetical protein 713 402 textmining:540
Rv3105c prfB peptide chain release factor PrfB 431 346
Rv2624c universal stress protein 469 250
Rv2625c rip3 zinc metalloprotease Rip3 716 218 textmining:652
Rv0715 rplX 50S ribosomal protein L24 447 214
Rv3129 Rv3129, (MTCY164.40), len: 110 aa. Conserved hypothetical protein, with some similarity to various hypothetical proteins from Streptomyces c 674 98 textmining:654
Rv1812c dehydrogenase 446 98 textmining:411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): RNA-splicing ligase RtcB
  • Pfam (hmmscan --cut_ga): RtcB PF01139.23 (E=4e-164)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217147.2)
  • Domains: Pfam-A via hmmscan --cut_ga — RtcB (PF01139.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1690
  • Curated reference: UniProt P9WGW5 (SwissProt, reviewed; Evidence at transcript level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2631|
MQVVNVATLPGIVRASYAMPDVHWGYGFPIGGVAATDVDNDGVVSPGGVGFDISCGVRLLVGEGLDREELQPRLPAVMDRLDRAIPRGVGTAGVWRLPDRNTLQEVLTGGARFAVEQGHGVALDLERCEDGGVMTGADAAKISDRALQRGLGQIGSLGSGNHFLEVQAVDRVYDPVAAAPMGLAEGTVCVMIHTGSRGLGHQICTDHVRQMEQAMGRYGIAVPDRQLACVPVHSPDGQAYLAAMAAAANYGRANRQLLTEATRRVFADATGTPLDLLYDVSHNLAKIETHPIDGQLRSVCVHRKGATRSLPPHHHELPAELAAVGQPVLIPGTMGTASYVLAGVTGNPAFFSTAHGAGRVLSRHQAARHTSGEAIRASLAKRGIIVRGTSRRGIAEEKPEAYKDVDEVIEASHQSGLARKVARLVPLGCVKG