pheA Resolved · high auto-curated

H37Rv Rv3838c · MTBC0 mtbc0_004068 · 321 aa · 4335815–4336780 MTBC0 (-) · RefSeq NP_218355.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand fadD23 (Rv3826) — requalified: long-chain-fatty-acid--CoA ligase FadD23 fadD23 tnpB (Rv2791c) — family_assigned: IS607 family element RNA-guided endonuclease TnpB tnpB Rv2792c (Rv2792c) — family_assigned: IS607-like element IS1537 family transposase Rv3829c (Rv3829c) — requalified: NAD(P)/FAD-dependent oxidoreductase Rv3829c Rv3830c (Rv3830c) — family_assigned: TetR/AcrR family transcriptional regulator Rv3831 (Rv3831) — family_assigned: DUF2834 domain-containing protein Rv3832c (Rv3832c) — family_assigned: methyltransferase domain-containing protein Rv3833 (Rv3833) — family_assigned: helix-turn-helix transcriptional regulator serS (Rv3834c) — requalified: serine--tRNA ligase serS Rv3835 (Rv3835) — family_assigned: septum formation family protein Rv3835 Rv3836 (Rv3836) — family_assigned: metallopeptidase family protein Rv3837c (Rv3837c) — family_assigned: histidine phosphatase family protein pheA (Rv3838c) — requalified: prephenate dehydratase pheA Rv3839 (Rv3839) — requalified: DUF2470 domain-containing protein bfrB (Rv3841) — requalified: ferritin BfrB glpQ1 (Rv3842c) — requalified: glycerophosphodiester phosphodiesterase glpQ1 Rv3843c (Rv3843c) — family_assigned: DUF4328 domain-containing protein Rv3843c Rv3845 (Rv3845) — family_assigned: IS110 family transposase sodA (Rv3846) — requalified: superoxide dismutase Rv3847 (Rv3847) — requalified: peptidase Rv3848 (Rv3848) — family_assigned: TMEM165/GDT1 family protein Rv3848 espR (Rv3849) — family_assigned: type VII secretion system ESX-1 transcriptional regulator Es Rv3850 (Rv3850) — family_assigned: DUF6474 family protein 4 328 kb 4 332 kb 4 336 kb 4 340 kb 4 344 kb 4 348 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)prephenate dehydratase
MTBC0 PGAP re-annotationprephenate dehydratase
Revised (this work)Prephenate dehydratase. Pfam: PDT (PF00800.24), ACT (PF01842.32).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 4 publications

4 TB publications mention this gene. 4 publication(s) discuss this gene (4 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).

PublicationDate
Transposon sequencing reveals metabolic pathways essential for Mycobacterium tuberculosis infection. doi:10.1371/journal.ppat.1011663 2024
Thiol specific oxidative stress response in Mycobacteria. doi:10.1016/j.femsle.2005.06.004 2005
pheA (Rv3838c) of Mycobacterium tuberculosis encodes an allosterically regulated monofunctional prephenate dehydratase that requires both catalytic and regulatory domains for optimum activity. doi:10.1074/jbc.M502107200 2005
The Mycobacterium tuberculosis IdeR is a dual functional regulator that controls transcription of genes involved in iron acquisition, iron storage and survival in macrophages. doi:10.1046/j.1365-2958.2001.02684.x 2001

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene

NeighbourpgmB (Rv3837c, - strand)
Overlap4 bp, 0 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index -7.83 (95% CI -9.07 to -6.37). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in L-phenylalanine biosynthesis [catalytic activity: prephenate = phenylpyruvate + H(2)O + CO(2)].
Mycobrowser EC 4.2.1.51 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3868c · 100.0% identity
M. leprae ML0078 · 84.2% identity
M. marinum MMAR_5390 · 77.6% identity
M. smegmatis MSMEG_6418 · 69.8% identity
M. orygis RJtmp_003952 · 100.0% identity
M. abscessus MAB_0132 · 63.4% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WIC3 SwissProt · reviewed · Evidence at protein level
UniProt namePrephenate dehydratase
EC (curated) EC 4.2.1.51

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namepheA
eggNOG descriptionPrephenate dehydratase
Orthologous groupCOG0077
EC number EC 4.2.1.51
KEGG orthology K04518
KEGG pathways map00400, map01100, map01110, map01130, map01230
KEGG modules M00024
Gene Ontology (61) GO:0003674, GO:0003824, GO:0004664, GO:0005488, GO:0005515, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006082, GO:0006520, GO:0006558 +49 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.332 · purifying
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.129 (low power) · 4 consensus substitution(s)
low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 78.7% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 9/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 52.6%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 13 in the ORF — 12 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.077, mean read count 69. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain

This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.

Hypomorph strainpheA-Flag-DAS-tetON-1 (TetON promoter 1)
Baseline knockdown fitness1.666 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown
Used in target deconvolutionno (Excluded - slow growth (less than 1 doubling in a screening wave))

Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection, day 45 (in vivo) -4.110.0 required
Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) +2.450.0046 required

Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 14 of 16 independent MS datasets
Integrated abundance143.0 ppm · rank 1044/3519 (70.4th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length321 aa
Molecular weight33.6 kDa
Theoretical pI5.23
GRAVY0.096 (hydrophobic)
Aliphatic index97.4
Aromaticity0.053
Instability index39.1 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PDTPF00800.24 3.9e-444–190 Prephenate dehydratase
ACTPF01842.32 1.6e-11207–267 ACT domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.9

PDB hitprobTM-scoreE-valueDescription
3mwb-assembly1_A 1.00 0.88 1.4e-33 sig 3mwb-assembly1_A The Crystal Structure of Prephenate dehydratase in complex with L-Phe from Arthrobacter aurescens to 2.0A
3mwb-assembly1_B 1.00 0.88 1.0e-31 sig 3mwb-assembly1_B The Crystal Structure of Prephenate dehydratase in complex with L-Phe from Arthrobacter aurescens to 2.0A
2qmx-assembly1_A 1.00 0.86 6.0e-26 sig 2qmx-assembly1_A The crystal structure of L-Phe inhibited prephenate dehydratase from Chlorobium tepidum TLS
6vh5-assembly1_C 1.00 0.87 1.9e-25 sig 6vh5-assembly1_C Crystal structure of prephenate dehydratase from brucella melitensis biovar abortus 2308 in complex with phenylalanine
7am0-assembly2_C 1.00 0.87 7.6e-25 sig 7am0-assembly2_C GqqA- a novel type of quorum quenching acylases

Foldseek search of the AlphaFold DB model (mean pLDDT 91.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Catalytic-site verification (M-CSA on the structural model) active site conserved

M-CSA entry485 · EC 4.2.1.51
Catalytic residues2/2 identical (2/2 aligned)
VerdictACTIVE-SITE CONSERVED (2/2 catalytic residues identical) -> likely active enzyme

Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv3837c (- strand, -4 bp gap)
Downstream (3' on genome)Rv3839 (+ strand, 95 bp gap)
Predicted operon Rv3837c · pheA

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) Rv2034 (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv3837c (phosphoglycerate mutase), high confidence from genomic context alone (score 884 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3754 tyrA exp prephenate dehydrogenase TyrA 992 946 database:900 textmining:874
Rv0948c exp chorismate mutase 940 909 database:900
Rv1885c exp chorismate mutase 937 909 database:900
Rv2231c cobC exp aminotransferase 916 908 database:900
Rv3772 hisC2 exp histidinol-phosphate aminotransferase 916 907 database:900
Rv1600 hisC1 exp histidinol-phosphate aminotransferase 916 907 database:900
Rv3837c phosphoglycerate mutase 884 884 ctx neighborhood:882
Rv1908c katG exp catalase-peroxidase 801 801 database:800
Rv3839 hyp hypothetical protein 784 784 ctx neighborhood:781
Rv3565 aspB exp aspartate aminotransferase AspB 779 768 ctx fusion:528 database:500
Rv3002c ilvN acetolactate synthase small subunit 731 709 ctx cooccurence:502
Rv2386c mbtI exp salicylate synthase 746 641 database:500
Rv0337c aspC exp aspartate aminotransferase 646 627 database:500
Rv3840 transcriptional regulator 609 594 ctx neighborhood:591
Rv0884c serC phosphoserine aminotransferase 660 557 coexpression:520

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: prephenate dehydratase
  • MTBC0 PGAP product: prephenate dehydratase
  • Pfam (hmmscan --cut_ga): PDT PF00800.24 (E=4e-44), ACT PF01842.32 (E=2e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218355.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PDT (PF00800.24), ACT (PF01842.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0077
  • Curated reference: UniProt P9WIC3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.9)
  • Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 485; catalytic residues aligned onto the structural model
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 49 functional partner(s); context anchor Rv3837c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004068|Rv3838c|pheA
MVRIAYLGPEGTFTEAALVRMVAAGLVPETGPDALQRMPVESAPAALAAVRDGGADYACVPIENSIDGSVLPTLDSLAIGVRLQVFAETTLDVTFSIVVKPGRNAADVRTLAAFPVAAAQVRQWLAAHLPAADLRPAYSNADAARQVADGLVDAAVTSPLAAARWGLAALADGVVDESNARTRFVLVGRPGPPPARTGADRTSAVLRIDNQPGALVAALAEFGIRGIDLTRIESRPTRTELGTYLFFVDCVGHIDDEAVAEALKAVHRRCADVRYLGSWPTGPAAGAQPPLVDEASRWLARLRAGKPEQTLVRPDDQGAQA