bcp Resolved · high auto-curated

H37Rv Rv2521 · MTBC0 mtbc0_002685 · 157 aa · 2860574–2861047 (+) · RefSeq NP_217037.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)peroxiredoxin
MTBC0 PGAP re-annotationthioredoxin-dependent thiol peroxidase
Revised (this work)Thioredoxin-dependent thiol peroxidase. Pfam: AhpC-TSA (PF00578.28), Redoxin (PF08534.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIE1 SwissProt · reviewed · Evidence at protein level
UniProt namePutative peroxiredoxin Rv2521
EC (curated) EC 1.11.1.24
Curated functionThiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events.

UniProt still lists this protein as Putative peroxiredoxin Rv2521; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred namebcp
eggNOG descriptionPeroxiredoxin
Orthologous groupCOG1225
EC number EC 1.11.1.15
KEGG orthology K03564
Gene Ontology (11) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0016020, GO:0044424, GO:0044444, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.172 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AhpC-TSAPF00578.28 3.9e-439–136 AhpC/TSA family
RedoxinPF08534.17 1.5e-289–151 Redoxin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2520c (membrane protein), high confidence from genomic context alone (score 784 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2520c membrane protein 783 784 ctx neighborhood:781
Rv2428 ahpC alkyl hydroperoxide reductase subunit AhpC 590 557 ctx cooccurence:467
Rv1229c mrp multiple resistance/pH adaptation protein 411 374
Rv3754 tyrA prephenate dehydrogenase TyrA 402 348
Rv3914 trxC thioredoxin TrxC 710 209 textmining:649
Rv1471 trxB1 thioredoxin 630 206 textmining:553
Rv1324 thioredoxin 415 206
Rv1470 trxA thioredoxin TrxA 431 201
Rv3913 trxB2 thioredoxin reductase 490 100 textmining:457
Rv1329c dinG ATP-dependent helicase DinG 649 41 textmining:649

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: peroxiredoxin
  • MTBC0 PGAP product: thioredoxin-dependent thiol peroxidase
  • Pfam (hmmscan --cut_ga): AhpC-TSA PF00578.28 (E=4e-43), Redoxin PF08534.17 (E=2e-28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217037.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AhpC-TSA (PF00578.28), Redoxin (PF08534.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1225
  • Curated reference: UniProt P9WIE1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor Rv2520c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002685|Rv2521|bcp
MTKTTRLTPGDKAPAFTLPDADGNNVSLADYRGRRVIVYFYPAASTPGCTKQACDFRDNLGDFTTAGLNVVGISPDKPEKLATFRDAQGLTFPLLSDPDREVLTAWGAYGEKQMYGKTVQGVIRSTFVVDEDGKIVVAQYNVKATGHVAKLRRDLSV