PE26 Family assigned · medium auto-curated
H37Rv Rv2519 · MTBC0 - ·
492 aa · 2835785–2837263 (+) ·
RefSeq YP_177888.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PE family protein PE26 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PE family protein PE26. Pfam: PE (PF00934.26), PGRS (PF21526.3), PE-PGRS_C (PF20729.3). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q79FD3
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | PE family protein PE26 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | acetylesterase activity |
| Orthologous group | COG0657 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.933 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 10 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 5.95% of strains (8637) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PE | PF00934.26 | 2.2e-28 | 4–93 | PE family |
PGRS | PF21526.3 | 9.0e-16 | 122–191 | PGRS repeats |
PE-PGRS_C | PF20729.3 | 5.5e-87 | 207–485 | PE-PGRS C-terminal aspartyl peptidase-like domain |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1364c |
sigma factor regulatory protein | 520 | 515 | coexpression:500 |
Rv3718c hyp |
hypothetical protein | 772 | 105 | textmining:756 |
Rv3207c hyp |
hypothetical protein | 446 | 60 | textmining:435 |
Rv1198 esxL |
ESAT-6 like protein EsxL | 526 | 46 | textmining:524 |
Rv0050 ponA1 |
bifunctional penicillin-insensitive transglycosylase/penicillin-sensitive transpeptidase | 625 | 43 | textmining:625 |
Rv3621c PPE65 |
PPE family protein PPE65 | 698 | 41 | textmining:698 |
Rv3344c PE_PGRS49 |
PE-PGRS family protein PE_PGRS49 | 657 | 41 | textmining:657 |
Rv3810 pirG |
cell surface protein | 656 | 41 | textmining:656 |
Rv0475 hbhA |
heparin binding hemagglutinin HbhA | 431 | 41 | textmining:432 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE26
- Pfam (hmmscan --cut_ga): PE PF00934.26 (E=2e-28), PGRS PF21526.3 (E=9e-16), PE-PGRS_C PF20729.3 (E=6e-87)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177888.1)
- Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26), PGRS (PF21526.3), PE-PGRS_C (PF20729.3)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0657 - Curated reference: UniProt Q79FD3 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 9 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2519|PE26 MSRLIVAPDWLASAAAEVQSIGSALSAANAAAAAPTTLLVAAAEDEVSAAAAALFANYGREYQTLSVRFASLDQQFAQALNSAAASYQTAEATGASLVQTATQGVLGVINAPTEFMFGRSLIGDGADGTAASPIGEPGGILYGDGGNGYSQTTPGAVGGAGGSAGFIGNGGAGGAGGPGAGGGTGGLGGWLWGNNGAAGTGDPVNVAVPLRVENNFPLVNLLVNRGPTVPILLDTGSSSLVIPFWKIGWQNLGLPTGFDVVHYGNGVSIVYADVPTTVDFGGGAATTPTSVHVGILPYPRNLDSLVLIASGGAFGPNGNGILGIGPNVGSYAVSGPGNVVTTDLPGQLNEGTLIDIPGGYMQFGPNTGTPITSVTGAPITVLNVQIGGYDPNGGYWSLPSIFDSGGNHGTLPAVILGTGQTTGYAPPGTVISISIHDNQTLLYQYTTTASNSPVVTADPRLNTGLTPFLLGPVYISNNPSGVGTVVFNYPPP