Rv2179c Resolved · high auto-curated

H37Rv Rv2179c · MTBC0 mtbc0_002314 · 168 aa · 2467818–2468324 (-) · RefSeq NP_216695.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)3'-5' exoribonuclease
MTBC0 PGAP re-annotationpolyadenylate-specific 3'-exoribonuclease AS
Revised (this work)Polyadenylate-specific 3'-exoribonuclease AS. Pfam: Rv2179c-like (PF16473.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJ73 SwissProt · reviewed · Evidence at protein level
UniProt name3'-5' exoribonuclease Rv2179c
EC (curated) EC 3.1.13.-
Curated functionExonuclease that cleaves single-stranded 3' overhangs of double-stranded RNA. Has no activity with 5' overhangs. Has negligible endonuclease activity. Can bind ATP, dATP and AMP (in vitro); the nucleotide occupies the predicted substrate binding site.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
eggNOG descriptionExonuclease that cleaves single-stranded 3' overhangs of double-stranded RNA
Orthologous group2CPKU
Gene Ontology (6) GO:0003674, GO:0005488, GO:0005515, GO:0008150, GO:0040007, GO:0042802

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.334 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rv2179c-likePF16473.12 6.4e-122–154 3'-5' exoribonuclease Rv2179c-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2180c (integral membrane protein), high confidence from genomic context alone (score 884 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2180c integral membrane protein 884 884 ctx neighborhood:882
Rv2178c aroG phospho-2-dehydro-3-deoxyheptonate aldolase AroG 789 779 ctx neighborhood:779
Rv2181 alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase 805 776 ctx neighborhood:775
Rv2744c 35kd_ag hyp hypothetical protein 773 774 ctx cooccurence:773
Rv0948c chorismate mutase 773 774 ctx cooccurence:773
Rv2468c hyp hypothetical protein 764 764 ctx cooccurence:764
Rv3605c hyp hypothetical protein 746 746 ctx cooccurence:746
Rv3412 hyp hypothetical protein 728 728 ctx cooccurence:728
Rv2520c membrane protein 721 721 ctx cooccurence:720
Rv2170 GCN5-like N-acetyltransferase 715 716 ctx cooccurence:714
Rv2754c thyX thymidylate synthase ThyX 713 713 ctx cooccurence:711
Rv1209 hyp hypothetical protein 702 702 ctx cooccurence:702
Rv3311 hyp hypothetical protein 700 700 ctx cooccurence:700
Rv1638A hyp hypothetical protein 682 682 ctx cooccurence:681
Rv3915 cwlM peptidoglycan hydrolase 670 670 ctx cooccurence:670

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 3'-5' exoribonuclease
  • MTBC0 PGAP product: polyadenylate-specific 3'-exoribonuclease AS
  • Pfam (hmmscan --cut_ga): Rv2179c-like PF16473.12 (E=6e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216695.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rv2179c-like (PF16473.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2CPKU
  • Curated reference: UniProt P9WJ73 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 46 functional partner(s); context anchor Rv2180c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002314|Rv2179c|
MRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQLRRFRLITSTDDAGRGAAR