acpS Resolved · high auto-curated

H37Rv Rv2523c · MTBC0 mtbc0_002687 · 130 aa · 2862428–2862820 (-) · RefSeq NP_217039.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)holo-ACP synthase
MTBC0 PGAP re-annotationholo-ACP synthase
Revised (this work)Holo-ACP synthase. Pfam: ACPS (PF01648.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQD3 SwissProt · reviewed · Evidence at protein level
UniProt nameHolo-[acyl-carrier-protein] synthase
EC (curated) EC 2.7.8.7
Curated functionTransfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. Involved in the post-translational modification of Fas-I and the AcpM subunit of Fas-II.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred nameacpS
eggNOG descriptionTransfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein
Orthologous groupCOG0736
EC number EC 2.7.8.7
KEGG orthology K00997
KEGG pathways map00770

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ACPSPF01648.26 2.4e-155–105 4'-phosphopantetheinyl transferase superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fas (fatty acid synthase), high confidence from genomic context alone (score 905 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1631 coaE dephospho-CoA kinase CoaE 915 907 database:900
Rv2524c fas fatty acid synthase 980 905 ctx neighborhood:738 cooccurence:644 textmining:805
Rv2522c hyp hypothetical protein 832 832 ctx neighborhood:817
Rv2940c mas multifunctional mycocerosic acid synthase 659 553 experimental:449
Rv1364c sigma factor regulatory protein 545 545 ctx neighborhood:544
Rv2048c pks12 polyketide synthase 651 542 experimental:449
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 645 535 experimental:449
Rv1527c pks5 polyketide synthase 643 533 experimental:449
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 642 531 experimental:449
Rv2946c pks1 polyketide synthase 570 519 experimental:449
Rv3800c pks13 polyketide synthase 737 507 experimental:449 textmining:491
Rv2380c mbtE peptide synthetase 574 506 experimental:449
Rv2932 ppsB phthiocerol synthesis polyketide synthase type I PpsB 558 506 experimental:449
Rv1181 pks4 polyketide beta-ketoacyl synthase 547 497 experimental:449
Rv1661 pks7 polyketide synthase 547 496 experimental:449

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: holo-ACP synthase
  • MTBC0 PGAP product: holo-ACP synthase
  • Pfam (hmmscan --cut_ga): ACPS PF01648.26 (E=2e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217039.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ACPS (PF01648.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0736
  • Curated reference: UniProt P9WQD3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s); context anchor fas
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002687|Rv2523c|acpS
MGIVGVGIDLVSIPDFAEQVDQPGTVFAETFTPGERRDASDKSSSAARHLAARWAAKEAVIKAWSGSRFAQRPVLPEDIHRDIEVVTDMWGRPRVRLTGAIAEYLADVTIHVSLTHEGDTAAAVAILEAP