acpS Resolved · high auto-curated
H37Rv Rv2523c · MTBC0 mtbc0_002687 ·
130 aa · 2862428–2862820 (-) ·
RefSeq NP_217039.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | holo-ACP synthase |
|---|---|
| MTBC0 PGAP re-annotation | holo-ACP synthase |
| Revised (this work) | Holo-ACP synthase. Pfam: ACPS (PF01648.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WQD3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Holo-[acyl-carrier-protein] synthase |
| EC (curated) |
EC 2.7.8.7
|
| Curated function | Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. Involved in the post-translational modification of Fas-I and the AcpM subunit of Fas-II. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | acpS |
| eggNOG description | Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein |
| Orthologous group | COG0736 |
| EC number |
EC 2.7.8.7
|
| KEGG orthology |
K00997
|
| KEGG pathways |
map00770
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ACPS | PF01648.26 | 2.4e-15 | 5–105 | 4'-phosphopantetheinyl transferase superfamily |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: fas (fatty acid synthase), high confidence from genomic context alone (score 905 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1631 coaE |
dephospho-CoA kinase CoaE | 915 | 907 | database:900 |
Rv2524c fas |
fatty acid synthase | 980 | 905 ctx | neighborhood:738 cooccurence:644 textmining:805 |
Rv2522c hyp |
hypothetical protein | 832 | 832 ctx | neighborhood:817 |
Rv2940c mas |
multifunctional mycocerosic acid synthase | 659 | 553 | experimental:449 |
Rv1364c |
sigma factor regulatory protein | 545 | 545 ctx | neighborhood:544 |
Rv2048c pks12 |
polyketide synthase | 651 | 542 | experimental:449 |
Rv2933 ppsC |
phthiocerol synthesis polyketide synthase type I PpsC | 645 | 535 | experimental:449 |
Rv1527c pks5 |
polyketide synthase | 643 | 533 | experimental:449 |
Rv3825c pks2 |
phthioceranic/hydroxyphthioceranic acid synthase | 642 | 531 | experimental:449 |
Rv2946c pks1 |
polyketide synthase | 570 | 519 | experimental:449 |
Rv3800c pks13 |
polyketide synthase | 737 | 507 | experimental:449 textmining:491 |
Rv2380c mbtE |
peptide synthetase | 574 | 506 | experimental:449 |
Rv2932 ppsB |
phthiocerol synthesis polyketide synthase type I PpsB | 558 | 506 | experimental:449 |
Rv1181 pks4 |
polyketide beta-ketoacyl synthase | 547 | 497 | experimental:449 |
Rv1661 pks7 |
polyketide synthase | 547 | 496 | experimental:449 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: holo-ACP synthase
- MTBC0 PGAP product: holo-ACP synthase
- Pfam (hmmscan --cut_ga): ACPS PF01648.26 (E=2e-15)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217039.1)
- Domains: Pfam-A via hmmscan --cut_ga — ACPS (PF01648.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0736 - Curated reference: UniProt P9WQD3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
38 functional partner(s); context anchor
fas - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002687|Rv2523c|acpS MGIVGVGIDLVSIPDFAEQVDQPGTVFAETFTPGERRDASDKSSSAARHLAARWAAKEAVIKAWSGSRFAQRPVLPEDIHRDIEVVTDMWGRPRVRLTGAIAEYLADVTIHVSLTHEGDTAAAVAILEAP