infC Resolved · high auto-curated

H37Rv Rv1641 · MTBC0 mtbc0_001750 · 201 aa · 1864294–1864899 (+) · RefSeq NP_216157.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)initiation factor IF-3
MTBC0 PGAP re-annotationtranslation initiation factor IF-3
Revised (this work)Translation initiation factor IF-3. Pfam: IF3_N (PF05198.22), IF3_C (PF00707.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKJ9 SwissProt · reviewed · Evidence at protein level
UniProt nameTranslation initiation factor IF-3
Curated functionIF-3 binds to the 30S ribosomal subunit and shifts the equilibrium between 70S ribosomes and their 50S and 30S subunits in favor of the free subunits, thus enhancing the availability of 30S subunits on which protein synthesis initiation begins.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred nameinfC
eggNOG descriptionIF-3 binds to the 30S ribosomal subunit and shifts the equilibrum between 70S ribosomes and their 50S and 30S subunits in favor of the free subunits, thus enhancing the availability of 30S subunits on which protein synthesis initiation begins
Orthologous groupCOG0290
KEGG orthology K02520
Gene Ontology (60) GO:0003674, GO:0003676, GO:0003723, GO:0003743, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006412 +48 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.961 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
IF3_NPF05198.22 1.0e-327–75 Translation initiation factor IF-3, N-terminal domain
IF3_CPF00707.28 3.1e-3284–168 Translation initiation factor IF-3, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplT (50S ribosomal protein L20), high confidence from genomic context alone (score 996 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1643 rplT 50S ribosomal protein L20 998 996 ctx neighborhood:750 cooccurence:578 coexpression:967 textmining:606
Rv1642 rpmI 50S ribosomal protein L35 997 994 ctx neighborhood:811 coexpression:968 textmining:622
Rv3460c rpsM 30S ribosomal protein S13 996 988 coexpression:942 experimental:765 textmining:731
Rv0683 rpsG 30S ribosomal protein S7 989 988 coexpression:888 experimental:882
Rv3459c rpsK 30S ribosomal protein S11 992 982 coexpression:859 experimental:878 textmining:588
Rv0705 rpsS 30S ribosomal protein S19 989 976 coexpression:849 experimental:849 textmining:587
Rv3462c infA translation initiation factor IF-1 992 953 coexpression:785 experimental:790 textmining:850
Rv1388 mihF integration host factor MihF 958 952 coexpression:731 experimental:765
Rv0682 rpsL 30S ribosomal protein S12 955 948 coexpression:906 experimental:474
Rv0640 rplK 50S ribosomal protein L11 972 946 coexpression:946 textmining:519
Rv2890c rpsB 30S ribosomal protein S2 972 935 coexpression:839 experimental:474 textmining:590
Rv0700 rpsJ 30S ribosomal protein S10 970 933 coexpression:877 experimental:474 textmining:585
Rv0053 rpsF 30S ribosomal protein S6 941 923 coexpression:852 experimental:474
Rv3458c rpsD 30S ribosomal protein S4 935 923 coexpression:859 experimental:474
Rv2785c rpsO 30S ribosomal protein S15 940 922 ctx cooccurence:403 coexpression:674 experimental:615

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: initiation factor IF-3
  • MTBC0 PGAP product: translation initiation factor IF-3
  • Pfam (hmmscan --cut_ga): IF3_N PF05198.22 (E=1e-32), IF3_C PF00707.28 (E=3e-32)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216157.1)
  • Domains: Pfam-A via hmmscan --cut_ga — IF3_N (PF05198.22), IF3_C (PF00707.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0290
  • Curated reference: UniProt P9WKJ9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 143 functional partner(s); context anchor rplT
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001750|Rv1641|infC
MSTETRVNERIRVPEVRLIGPGGEQVGIVRIEDALRVAADADLDLVEVAPNARPPVCKIMDYGKYKYEAAQKARESRRNQQQTVVKEQKLRPKIDDHDYETKKGHVVRFLEAGSKVKVTIMFRGREQSRPELGYRLLQRLGADVADYGFIETSAKQDGRNMTMVLAPHRGAKTRARARHPGEPAGGPPPKPTAGDSKAAPN