Rv3055 Family assigned · medium auto-curated

H37Rv Rv3055 · MTBC0 mtbc0_003247 · 204 aa · 3437377–3437991 (+) · RefSeq NP_217571.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)TetR family transcriptional regulator
MTBC0 PGAP re-annotationhelix-turn-helix domain-containing protein
Revised (this work)Helix-turn-helix domain-containing protein. Pfam: TetR_N (PF00440.30).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95103 TrEMBL · unreviewed · Predicted
UniProt namePossible transcriptional regulatory protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptiontetR family
Orthologous groupCOG1309

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.369 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TetR_NPF00440.30 3.5e-1432–74 Bacterial regulatory proteins, tetR family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: moaR1 (transcriptional regulator MoaR), high confidence from genomic context alone (score 883 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3124 moaR1 transcriptional regulator MoaR 885 883 ctx cooccurence:544 coexpression:754
Rv3056 dinP DNA polymerase IV 2 905 876 ctx neighborhood:876
Rv1725c hyp hypothetical protein 872 869 coexpression:850
Rv0737 transcriptional regulator 865 865 coexpression:819
Rv1167c transcriptional regulator 864 864 ctx cooccurence:445 coexpression:765
Rv1267c embR transcriptional regulator EmbR 860 857 coexpression:804
Rv0117 oxyS oxidative stress response regulatory protein OxyS 851 846 coexpression:801
Rv3167c TetR family transcriptional regulator 837 838 coexpression:802
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 838 834 coexpression:806
Rv1189 sigI ECF RNA polymerase sigma factor SigI 832 832 coexpression:803
Rv3830c TetR family transcriptional regulator 835 831 coexpression:799
Rv3183 higA3 transcriptional regulator 824 825 coexpression:800
Rv3054c hyp hypothetical protein 828 824 ctx neighborhood:736
Rv1985c lysG HTH-type transcriptional regulator 825 822 coexpression:800
Rv3840 transcriptional regulator 820 821 coexpression:797

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: TetR family transcriptional regulator
  • MTBC0 PGAP product: helix-turn-helix domain-containing protein
  • Pfam (hmmscan --cut_ga): TetR_N PF00440.30 (E=4e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217571.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TetR_N (PF00440.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1309
  • Curated reference: UniProt P95103 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 64 functional partner(s); context anchor moaR1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003247|Rv3055|
MSGAERLGDLPVFARQEPVPERGDAARNRALLLEAARRLIARSGADAITMDDVAAAAGVGKGTLFRRFGSRAGLMMVLLDEDERASQQAFLFGPPPLGPDAPPLDRLIAFGRERMRFVHAHHQLLSEANRDPQTRHSAALSVLRTHLRVLLASAPTTGDLDAQTDALLALLDVDYVEHQLNAGGHTLQTLGDAWESLARKLCGR