ndkA Resolved · high auto-curated
H37Rv Rv2445c · MTBC0 mtbc0_002604 ·
136 aa ·
2769562–2769972 MTBC0
(-) ·
RefSeq NP_216961.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | nucleoside diphosphate kinase |
|---|---|
| MTBC0 PGAP re-annotation | nucleoside-diphosphate kinase |
| Revised (this work) | Nucleoside-diphosphate kinase. Pfam: NDK (PF00334.25). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 1 publication
1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Peripheral blood and pleural fluid mononuclear cell responses to low-molecular-mass secretory polypeptides of Mycobacterium tuberculosis in human models of immunity to tuberculosis. doi:10.1128/IAI.73.6.3547-3558.2005 | 2005 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -2.17 (95% CI -5.40 to 1.60). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Major role in the synthesis of nucleoside triphosphates other than ATP [catalytic activity: ATP + nucleoside diphosphate = ADP + nucleoside triphosphate]. |
|---|---|
| Mycobrowser EC |
2.7.4.6
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2472c
· 99.3% identity |
|---|---|
| M. leprae |
ML1469c
· 88.1% identity |
| M. marinum |
MMAR_3769
· 88.2% identity |
| M. smegmatis |
MSMEG_4627
· 80.7% identity |
| M. orygis |
RJtmp_002528
· 99.3% identity |
| M. abscessus |
MAB_1606
· 75.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WJH7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Nucleoside diphosphate kinase |
| EC (curated) |
EC 2.7.4.6
|
| Curated function | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | ndk |
| eggNOG description | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate |
| Orthologous group | COG0105 |
| EC number |
EC 2.7.4.6
|
| KEGG orthology |
K00940
|
| KEGG pathways |
map00230, map00240, map00983, map01100, map01110, map01130, map04016
|
| KEGG modules |
M00049, M00050, M00052, M00053
|
| Gene Ontology (69) |
GO:0003674, GO:0003824, GO:0004518, GO:0004550, GO:0005575, GO:0005576, GO:0005622, GO:0005623, GO:0005886, GO:0006139, GO:0006163, GO:0006165 +57 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 84.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 66.5% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 5 in the ORF — 0 in the essential state, 0 growth-defect, 5 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 25.6. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 5 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 5 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1028.0 ppm · rank 222/3519 (93.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 136 aa |
|---|---|
| Molecular weight | 14.5 kDa |
| Theoretical pI | 5.34 |
| GRAVY | 0.106 (hydrophobic) |
| Aliphatic index | 102.7 |
| Aromaticity | 0.059 |
| Instability index | 36.0 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
NDK | PF00334.25 | 2.5e-54 | 3–134 | Nucleoside diphosphate kinase |
Experimental structures (Protein Data Bank) 5 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
4ane |
X-ray diffraction | 1.9 Å | 100% |
6qa2 |
X-ray diffraction | 2.2 Å | 100% |
1k44 |
X-ray diffraction | 2.6 Å | 100% |
4anc |
X-ray diffraction | 2.8 Å | 100% |
4and |
X-ray diffraction | 2.808 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (5 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1k44-assembly1_A |
1.00 | 0.99 | 1.4e-23 sig | 1k44-assembly1_A Mycobacterium tuberculosis Nucleoside Diphosphate Kinase |
4ane-assembly1_E |
1.00 | 0.99 | 2.4e-23 sig | 4ane-assembly1_E R80N MUTANT OF NUCLEOSIDE DIPHOSPHATE KINASE FROM MYCOBACTERIUM TUBERCULOSIS |
6qa2-assembly1_C |
1.00 | 0.98 | 2.9e-23 sig | 6qa2-assembly1_C R80A MUTANT OF NUCLEOSIDE DIPHOSPHATE KINASE FROM MYCOBACTERIUM TUBERCULOSIS |
4anc-assembly1_A |
1.00 | 0.99 | 4.9e-22 sig | 4anc-assembly1_A CRYSTAL FORM I OF THE D93N MUTANT OF NUCLEOSIDE DIPHOSPHATE KINASE FROM MYCOBACTERIUM TUBERCULOSIS |
5u2i-assembly1_B |
1.00 | 0.97 | 5.4e-18 sig | 5u2i-assembly1_B Crystal structure of a nucleoside diphosphate kinase from Naegleria fowleri |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | rne (- strand, 329 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2446c (- strand, 42 bp gap) |
| Predicted operon |
ndkA · Rv2446c · folC · valS
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: rplU (50S ribosomal protein L21), high confidence from genomic context alone (score 964 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0700 rpsJ exp |
30S ribosomal protein S10 | 994 | 995 | coexpression:794 experimental:847 database:844 |
Rv0682 rpsL exp |
30S ribosomal protein S12 | 994 | 994 | coexpression:769 experimental:845 database:844 |
Rv2785c rpsO exp |
30S ribosomal protein S15 | 993 | 994 | coexpression:728 experimental:859 database:844 |
Rv2890c rpsB exp |
30S ribosomal protein S2 | 993 | 993 | coexpression:696 experimental:858 database:844 |
Rv0683 rpsG exp |
30S ribosomal protein S7 | 993 | 993 | coexpression:729 experimental:845 database:844 |
Rv2909c rpsP exp |
30S ribosomal protein S16 | 992 | 992 | coexpression:558 experimental:887 database:844 |
Rv0053 rpsF exp |
30S ribosomal protein S6 | 991 | 992 | coexpression:666 experimental:851 database:844 |
Rv3459c rpsK exp |
30S ribosomal protein S11 | 991 | 991 | coexpression:655 experimental:845 database:844 |
Rv3442c rpsI exp |
30S ribosomal protein S9 | 987 | 987 | coexpression:491 experimental:850 database:844 |
Rv0721 rpsE exp |
30S ribosomal protein S5 | 986 | 986 | coexpression:452 experimental:847 database:844 |
Rv2442c rplU exp |
50S ribosomal protein L21 | 963 | 964 ctx | neighborhood:474 coexpression:701 experimental:789 |
Rv2056c rpsN2 exp |
30S ribosomal protein S14 | 957 | 957 | coexpression:469 experimental:780 database:662 |
Rv0717 rpsN1 exp |
30S ribosomal protein S14 | 957 | 957 | coexpression:470 experimental:780 database:662 |
Rv1307 atpH |
ATP synthase subunit b/delta | 946 | 945 | coexpression:931 |
Rv2441c rpmA exp |
50S ribosomal protein L27 | 944 | 944 | coexpression:649 experimental:789 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: nucleoside diphosphate kinase
- MTBC0 PGAP product: nucleoside-diphosphate kinase
- Pfam (hmmscan --cut_ga): NDK PF00334.25 (E=3e-54)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216961.1)
- Domains: Pfam-A via hmmscan --cut_ga — NDK (PF00334.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0105 - Curated reference: UniProt P9WJH7 (SwissProt, reviewed; Evidence at protein level)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
226 functional partner(s); context anchor
rplU - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002604|Rv2445c|ndkA MTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for ndkA? Email the maintainer — the message is pre-filled with this gene's details.