Rv2437 Family assigned · medium auto-curated

H37Rv Rv2437 · MTBC0 mtbc0_002595 · 139 aa · 2758624–2759043 (+) · RefSeq NP_216953.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationisoprenylcysteine carboxylmethyltransferase family protein
Revised (this work)Isoprenylcysteine carboxylmethyltransferase family protein. Pfam: PEMT (PF04191.19), ICMT (PF04140.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71912 TrEMBL · unreviewed · Predicted
UniProt nameConserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
eggNOG descriptionIsoprenylcysteine carboxyl methyltransferase (ICMT) family
Orthologous groupCOG2020

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PEMTPF04191.19 5.9e-1121–116 Phospholipid methyltransferase
ICMTPF04140.20 5.9e-1129–113 Isoprenylcysteine carboxyl methyltransferase (ICMT) family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rbsK (ribokinase RbsK), high confidence from genomic context alone (score 741 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2436 rbsK ribokinase RbsK 742 741 ctx neighborhood:728
Rv0701 rplC 50S ribosomal protein L3 461 461
Rv0709 rpmC 50S ribosomal protein L29 431 432
Rv3460c rpsM 30S ribosomal protein S13 409 410 coexpression:409
Rv1388 mihF integration host factor MihF 409 410 coexpression:409
Rv0538 membrane protein 425 405 coexpression:403
Rv2191 hyp hypothetical protein 404 380

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: isoprenylcysteine carboxylmethyltransferase family protein
  • Pfam (hmmscan --cut_ga): PEMT PF04191.19 (E=6e-11), ICMT PF04140.20 (E=6e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216953.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PEMT (PF04191.19), ICMT (PF04140.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2020
  • Curated reference: UniProt P71912 (TrEMBL, unreviewed; Predicted)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 7 functional partner(s); context anchor rbsK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002595|Rv2437|
MLQRTNVVQPLNTLRMVWIQVAGIIPATAGIAATVYAQLAMGDSWRIGVDEQENTTLVRTGPFKWVRHPIYTAMMAFGLGLLLVTPNLVALAGFILLVATLEVHVRRVEEPYLLRTHSAVYRGYTASVGRFVPGVGLIR