Rv2437 Family assigned · medium auto-curated
H37Rv Rv2437 · MTBC0 mtbc0_002595 ·
139 aa · 2758624–2759043 (+) ·
RefSeq NP_216953.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transmembrane protein |
|---|---|
| MTBC0 PGAP re-annotation | isoprenylcysteine carboxylmethyltransferase family protein |
| Revised (this work) | Isoprenylcysteine carboxylmethyltransferase family protein. Pfam: PEMT (PF04191.19), ICMT (PF04140.20). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P71912
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Conserved transmembrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
O Post-translational modification, protein turnover, chaperones
|
|---|---|
| eggNOG description | Isoprenylcysteine carboxyl methyltransferase (ICMT) family |
| Orthologous group | COG2020 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PEMT | PF04191.19 | 5.9e-11 | 21–116 | Phospholipid methyltransferase |
ICMT | PF04140.20 | 5.9e-11 | 29–113 | Isoprenylcysteine carboxyl methyltransferase (ICMT) family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: rbsK (ribokinase RbsK), high confidence from genomic context alone (score 741 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2436 rbsK |
ribokinase RbsK | 742 | 741 ctx | neighborhood:728 |
Rv0701 rplC |
50S ribosomal protein L3 | 461 | 461 | |
Rv0709 rpmC |
50S ribosomal protein L29 | 431 | 432 | |
Rv3460c rpsM |
30S ribosomal protein S13 | 409 | 410 | coexpression:409 |
Rv1388 mihF |
integration host factor MihF | 409 | 410 | coexpression:409 |
Rv0538 |
membrane protein | 425 | 405 | coexpression:403 |
Rv2191 hyp |
hypothetical protein | 404 | 380 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transmembrane protein
- MTBC0 PGAP product: isoprenylcysteine carboxylmethyltransferase family protein
- Pfam (hmmscan --cut_ga): PEMT PF04191.19 (E=6e-11), ICMT PF04140.20 (E=6e-11)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216953.1)
- Domains: Pfam-A via hmmscan --cut_ga — PEMT (PF04191.19), ICMT (PF04140.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2020 - Curated reference: UniProt P71912 (TrEMBL, unreviewed; Predicted)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
7 functional partner(s); context anchor
rbsK - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002595|Rv2437| MLQRTNVVQPLNTLRMVWIQVAGIIPATAGIAATVYAQLAMGDSWRIGVDEQENTTLVRTGPFKWVRHPIYTAMMAFGLGLLLVTPNLVALAGFILLVATLEVHVRRVEEPYLLRTHSAVYRGYTASVGRFVPGVGLIR