Rv2456c Resolved · high auto-curated

H37Rv Rv2456c · MTBC0 mtbc0_002615 · 418 aa · 2781184–2782440 (-) · RefSeq NP_216972.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)MFS-type transporter
MTBC0 PGAP re-annotationMFS transporter
Revised (this work)MFS transporter. Pfam: MFS_1 (PF07690.22), MFS_1_like (PF12832.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJX1 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized MFS-type transporter Rv2456c

UniProt still lists this protein as Uncharacterized MFS-type transporter Rv2456c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
G Carbohydrate transport and metabolism
P Inorganic ion transport and metabolism
eggNOG descriptionThought to be involved in transport of undeterminated substrate (possibly sugar) across the membrane. responsible for the translocation of the substrate across the membrane
Orthologous groupCOG0477

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.001 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MFS_1PF07690.22 2.2e-3321–344 Major Facilitator Superfamily
MFS_1_likePF12832.14 4.6e-1530–372 MFS_1 like family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: clpX (ATP-dependent CLP protease ATP-binding subunit ClpX), high confidence from genomic context alone (score 821 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2457c clpX ATP-dependent CLP protease ATP-binding subunit ClpX 912 821 ctx neighborhood:812 textmining:530
Rv2454c korB 2-oxoglutarate oxidoreductase subunit KorB 692 659 ctx neighborhood:659
Rv2453c mobA molybdenum cofactor guanylyltransferase 796 568 ctx neighborhood:563 textmining:547
Rv2289 cdh CDP-diacylglycerol pyrophosphatase 503 504 ctx cooccurence:489
Rv2455c korA 2-oxoglutarate oxidoreductase subunit KorA 563 501 ctx neighborhood:501
Rv2458 mmuM homocysteine S-methyltransferase MmuM 431 431 ctx neighborhood:419
Rv3190c hyp hypothetical protein 413 413 ctx cooccurence:410
Rv2452c hyp hypothetical protein 402 402
Rv3402c hyp hypothetical protein 892 233 textmining:866
Rv2425c hyp hypothetical protein 871 53 textmining:870
Rv1624c membrane protein 870 47 textmining:870

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: MFS-type transporter
  • MTBC0 PGAP product: MFS transporter
  • Pfam (hmmscan --cut_ga): MFS_1 PF07690.22 (E=2e-33), MFS_1_like PF12832.14 (E=5e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216972.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MFS_1 (PF07690.22), MFS_1_like (PF12832.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0477
  • Curated reference: UniProt P9WJX1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor clpX
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002615|Rv2456c|
MSGTVVAVPPRVARALDLLNFSLADVRDGLGPYLSIYLLLIHDWDQASIGFVMAVGGIAAIVAQTPIGALVDRTTAKRALVVAGAVLVTAAAVAMPLFAGLYSISVLQAVTGIASSVFAPALAAITLGAVGPQFFARRIGRNEAFNHAGNASAAGATGALAYFFGPVVVFWVLAGMALISVLATLRIPPDAVDHDLARGMDHAPGEPHPQPSRFTVLAHNRELVIFGAAVVAFHFANAAMLPLVGELLALHNRDEGTALMSSCIVAAQVVMVPVAYVVGTRADAWGRKPIFLVGFAVLTARGFLYTLSDNSYWLVGVQLLDGIGAGIFGALFPLVVQDVTHGTGHFNISLGAVTTATGIGAALSNLVAGWIVVVAGYDAAFMSLGALAGAGFLLYLVAMPETVDSDVRVRSRPTLGGK