mobA Resolved · high auto-curated

H37Rv Rv2453c · MTBC0 mtbc0_002612 · 201 aa · 2777266–2777871 (-) · RefSeq NP_216969.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)molybdenum cofactor guanylyltransferase
MTBC0 PGAP re-annotationmolybdenum cofactor guanylyltransferase
Revised (this work)Molybdenum cofactor guanylyltransferase. Pfam: NTP_transf_3 (PF12804.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJQ9 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable molybdenum cofactor guanylyltransferase
EC (curated) EC 2.7.7.77
Curated functionTransfers a GMP moiety from GTP to Mo-molybdopterin (Mo-MPT) cofactor (Moco or molybdenum cofactor) to form Mo-molybdopterin guanine dinucleotide (Mo-MGD) cofactor.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namemobA
eggNOG descriptionTransfers a GMP moiety from GTP to Mo-molybdopterin (Mo- MPT) cofactor (Moco or molybdenum cofactor) to form Mo- molybdopterin guanine dinucleotide (Mo-MGD) cofactor
Orthologous groupCOG0746
EC number EC 2.7.7.77
KEGG orthology K03752
KEGG pathways map00790, map01100
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NTP_transf_3PF12804.14 1.8e-3113–169 MobA-like NTP transferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: korB (2-oxoglutarate oxidoreductase subunit KorB), high confidence from genomic context alone (score 979 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2454c korB 2-oxoglutarate oxidoreductase subunit KorB 995 979 ctx neighborhood:881 coexpression:829 textmining:803
Rv0438c moeA2 molybdopterin molybdenumtransferase 957 952 database:900
Rv0994 moeA1 molybdopterin molybdenumtransferase 1 952 946 database:900
Rv0371c hyp hypothetical protein 909 906 database:900
Rv0345 hyp hypothetical protein 909 906 database:900
Rv2455c korA 2-oxoglutarate oxidoreductase subunit KorA 978 896 ctx neighborhood:881 textmining:803
Rv2457c clpX ATP-dependent CLP protease ATP-binding subunit ClpX 722 722 ctx neighborhood:721
Rv2452c hyp hypothetical protein 721 722 ctx neighborhood:715
Rv2458 mmuM homocysteine S-methyltransferase MmuM 592 592 ctx neighborhood:589
Rv2456c MFS-type transporter 796 568 ctx neighborhood:563 textmining:547
Rv3109 moaA1 cyclic pyranopterin monophosphate synthase 561 502
Rv0869c moaA2 molybdenum cofactor biosynthesis protein MoaA 540 479
Rv2899c fdhD formate dehydrogenase accessory protein FdhD 675 456 textmining:428
Rv3149 nuoE NADH-quinone oxidoreductase subunit E 430 430
Rv1606 hisI phosphoribosyl-AMP cyclohydrolase 411 412 coexpression:412

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: molybdenum cofactor guanylyltransferase
  • MTBC0 PGAP product: molybdenum cofactor guanylyltransferase
  • Pfam (hmmscan --cut_ga): NTP_transf_3 PF12804.14 (E=2e-31)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216969.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NTP_transf_3 (PF12804.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0746
  • Curated reference: UniProt P9WJQ9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor korB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002612|Rv2453c|mobA
MAELAPDTVPLAGVVLAGGESRRMGRDKATLPLPGGTTTLVEHMVGILGQRCAPVFVMAAPGQPLPTLPVPVLRDELPGLGPLPATGRGLRAAAEAGVRLAFVCAVDMPYLTVELIEDLARRAVQTDAEVVLPWDGRNHYLAAVYRTDLADRVDTLVGAGERKMSALVDASDALRIVMADSRPLTNVNSAAGLHAPMQPGR