mobA Resolved · high auto-curated
H37Rv Rv2453c · MTBC0 mtbc0_002612 ·
201 aa · 2777266–2777871 (-) ·
RefSeq NP_216969.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | molybdenum cofactor guanylyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | molybdenum cofactor guanylyltransferase |
| Revised (this work) | Molybdenum cofactor guanylyltransferase. Pfam: NTP_transf_3 (PF12804.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJQ9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable molybdenum cofactor guanylyltransferase |
| EC (curated) |
EC 2.7.7.77
|
| Curated function | Transfers a GMP moiety from GTP to Mo-molybdopterin (Mo-MPT) cofactor (Moco or molybdenum cofactor) to form Mo-molybdopterin guanine dinucleotide (Mo-MGD) cofactor. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | mobA |
| eggNOG description | Transfers a GMP moiety from GTP to Mo-molybdopterin (Mo- MPT) cofactor (Moco or molybdenum cofactor) to form Mo- molybdopterin guanine dinucleotide (Mo-MGD) cofactor |
| Orthologous group | COG0746 |
| EC number |
EC 2.7.7.77
|
| KEGG orthology |
K03752
|
| KEGG pathways |
map00790, map01100
|
| Gene Ontology (6) |
GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
NTP_transf_3 | PF12804.14 | 1.8e-31 | 13–169 | MobA-like NTP transferase domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: korB (2-oxoglutarate oxidoreductase subunit KorB), high confidence from genomic context alone (score 979 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2454c korB |
2-oxoglutarate oxidoreductase subunit KorB | 995 | 979 ctx | neighborhood:881 coexpression:829 textmining:803 |
Rv0438c moeA2 |
molybdopterin molybdenumtransferase | 957 | 952 | database:900 |
Rv0994 moeA1 |
molybdopterin molybdenumtransferase 1 | 952 | 946 | database:900 |
Rv0371c hyp |
hypothetical protein | 909 | 906 | database:900 |
Rv0345 hyp |
hypothetical protein | 909 | 906 | database:900 |
Rv2455c korA |
2-oxoglutarate oxidoreductase subunit KorA | 978 | 896 ctx | neighborhood:881 textmining:803 |
Rv2457c clpX |
ATP-dependent CLP protease ATP-binding subunit ClpX | 722 | 722 ctx | neighborhood:721 |
Rv2452c hyp |
hypothetical protein | 721 | 722 ctx | neighborhood:715 |
Rv2458 mmuM |
homocysteine S-methyltransferase MmuM | 592 | 592 ctx | neighborhood:589 |
Rv2456c |
MFS-type transporter | 796 | 568 ctx | neighborhood:563 textmining:547 |
Rv3109 moaA1 |
cyclic pyranopterin monophosphate synthase | 561 | 502 | |
Rv0869c moaA2 |
molybdenum cofactor biosynthesis protein MoaA | 540 | 479 | |
Rv2899c fdhD |
formate dehydrogenase accessory protein FdhD | 675 | 456 | textmining:428 |
Rv3149 nuoE |
NADH-quinone oxidoreductase subunit E | 430 | 430 | |
Rv1606 hisI |
phosphoribosyl-AMP cyclohydrolase | 411 | 412 | coexpression:412 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: molybdenum cofactor guanylyltransferase
- MTBC0 PGAP product: molybdenum cofactor guanylyltransferase
- Pfam (hmmscan --cut_ga): NTP_transf_3 PF12804.14 (E=2e-31)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216969.1)
- Domains: Pfam-A via hmmscan --cut_ga — NTP_transf_3 (PF12804.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0746 - Curated reference: UniProt P9WJQ9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
21 functional partner(s); context anchor
korB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002612|Rv2453c|mobA MAELAPDTVPLAGVVLAGGESRRMGRDKATLPLPGGTTTLVEHMVGILGQRCAPVFVMAAPGQPLPTLPVPVLRDELPGLGPLPATGRGLRAAAEAGVRLAFVCAVDMPYLTVELIEDLARRAVQTDAEVVLPWDGRNHYLAAVYRTDLADRVDTLVGAGERKMSALVDASDALRIVMADSRPLTNVNSAAGLHAPMQPGR