Rv2182c Family assigned · medium auto-curated

H37Rv Rv2182c · MTBC0 mtbc0_002317 · 247 aa · 2470593–2471336 (-) · RefSeq NP_216698.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)	1-acylglycerol-3-phosphate O-acyltransferase
MTBC0 PGAP re-annotation	lysophospholipid acyltransferase family protein
Revised (this work)	Lysophospholipid acyltransferase family protein. Pfam: Acyltransferase (PF01553.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt	`O53516` TrEMBL · unreviewed · Evidence at protein level
UniProt name	1-acylglycerol-3-phosphate O-acyltransferase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category	`I` Lipid transport and metabolism
Preferred name	plsC
eggNOG description	Acyltransferase
Orthologous group	`COG0204`
EC number	`EC 2.3.1.51`
KEGG orthology	`K00655`
KEGG pathways	`map00561`, `map00564`, `map01100`, `map01110`
KEGG modules	`M00089`

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS	0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains)	1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

Pfam	Accession	i-Evalue	Residues	Description
`Acyltransferase`	PF01553.27	6.6e-31	21–151	Acyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Partner	Product	Score	No text-mining	Channels (≥400)
`Rv2881c` cdsA	phosphatidate cytidylyltransferase	960	905	database:900 textmining:604
`Rv2482c` plsB2	glycerol-3-phosphate acyltransferase	925	905	database:900
`Rv1551` plsB1	acyltransferase PlsB	908	904	database:900
`Rv2252` dagK	diacylglycerol kinase	906	903	database:900
`Rv2289` cdh	CDP-diacylglycerol pyrophosphatase	901	901	database:900
`Rv2982c` gpdA2	glycerol-3-phosphate dehydrogenase	923	891	database:800
`Rv0564c` gpdA1	glycerol-3-phosphate dehydrogenase	878	852	database:800
`Rv2184c` hyp	hypothetical protein	819	819 ctx	neighborhood:782
`Rv3302c` glpD2	glycerol-3-phosphate dehydrogenase	818	809	database:800
`Rv2249c` glpD1	glycerol-3-phosphate dehydrogenase	817	808	database:800
`Rv2183c` hyp	hypothetical protein	784	784 ctx	neighborhood:782
`Rv2185c` TB16.3 hyp	hypothetical protein	707	707 ctx	neighborhood:702
`Rv0425c` ctpH	metal cation transporting ATPase H	479	478	database:451
`Rv1997` ctpF	cation transporter ATPase F	466	466	database:451
`Rv0908` ctpE	metal cation transporter ATPase E	466	466	database:451

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

Legacy H37Rv annotation: 1-acylglycerol-3-phosphate O-acyltransferase
MTBC0 PGAP product: lysophospholipid acyltransferase family protein
Pfam (hmmscan --cut_ga): Acyltransferase PF01553.27 (E=7e-31)
(auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216698.1)
Domains: Pfam-A via hmmscan --cut_ga — Acyltransferase (PF01553.27)
Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0204
Curated reference: UniProt O53516 (TrEMBL, unreviewed; Evidence at protein level)
Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 35 functional partner(s)
Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002317|Rv2182c|
MWYYLFKYIFMGPLFTLLGRPKVEGLEYIPSSGPAILASNHLAVADSFYLPLVVRRRIWFLAKSEYFTGTGLKGWINRWFYSVSGQVPIDRTNADSAQGALQTAVVLLGQGKLLGMYPEGTRSPDGRLYKGKTGLARLALHTGVPVIPVAMIGTNVVNPPGRKMLRFGRVTVRFGKPMDFSRFEGLAGNHFIERAVTDEVIYELMGLSGQEYVDIYAASVKDGRNAGGAGANPNSTDAARIPETAAG