Rv2182c Family assigned · medium auto-curated

H37Rv Rv2182c · MTBC0 mtbc0_002317 · 247 aa · 2470593–2471336 MTBC0 (-) · RefSeq NP_216698.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)1-acylglycerol-3-phosphate O-acyltransferase
MTBC0 PGAP re-annotationlysophospholipid acyltransferase family protein
Revised (this work)Lysophospholipid acyltransferase family protein. Pfam: Acyltransferase (PF01553.27).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).

PublicationDate
Probing Differences in Gene Essentiality Between the Human and Animal Adapted Lineages of the Mycobacterium tuberculosis Complex Using TnSeq. doi:10.3389/fvets.2021.760717 2021

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Intrinsic disorder (sequence + structure) partially disordered

Predicted disorder17% of residues (metapredict) · mean AlphaFold pLDDT 84.9
Disordered regions2 IDR(s), longest 26 aa [0-17, 221-247]

carries a substantial disordered region (43/247 residues); disorder is a property, not a function

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

CRISPRi vulnerability

Vulnerability index -6.46 (95% CI -7.14 to -5.73). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser) ahead of Mycobrowser

Mycobrowser functionTransfer of fatty acyl groups
Mycobrowser EC 2.3.1.51 · agrees with the atlas

Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (EC number, COG category). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2204c · 100.0% identity
M. leprae ML0892 · 79.8% identity
M. marinum MMAR_3226 · 89.1% identity
M. smegmatis MSMEG_4248 · 74.9% identity
M. orygis RJtmp_002252 · 100.0% identity
M. abscessus MAB_1984 · 70.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O53516 TrEMBL · unreviewed · Evidence at protein level
UniProt name1-acylglycerol-3-phosphate O-acyltransferase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred nameplsC
eggNOG descriptionAcyltransferase
Orthologous groupCOG0204
EC number EC 2.3.1.51
KEGG orthology K00655
KEGG pathways map00561, map00564, map01100, map01110
KEGG modules M00089

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 83.6% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 11/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 56.7%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 22 in the ORF — 21 in the essential state, 0 growth-defect, 0 non-essential, 1 growth-advantage. Saturation 0.045, mean read count 48. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain

This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.

Hypomorph strainRv2182c::FLAG-DAS Giles::pTetON-18_sspB (TetON promoter 18)
Baseline knockdown fitness2.905 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown
Used in target deconvolutionyes (informs phenotypic-cluster / MOA assignment)

Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.

Mutant phenotypes (conditional Tn-seq, MtbTnDB)

Conditionlog2FCqEffect
Differential genetic requirements of clinical Mtb strain (ID=663) from Euro-American lineage (compared to H37Rv control) (strain background) +7.440.0 required
Differential genetic requirements of clinical Mtb strain (ID=641) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) +5.170.0096 required
Differential genetic requirements of clinical Mtb strain (ID=667) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) +5.070.018 required
Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) +4.420.016 required
Differential genetic requirements of clinical Mtb strain (ID=662) from East Asian lineage (compared to H37Rv control) (strain background) +4.060.011 required
Differential genetic requirements of clinical Mtb strain (ID=630) from Euro-American lineage (compared to H37Rv control) (strain background) +4.000.0085 required

Conditional fitness of transposon-disruption mutants across 6 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 12 of 16 independent MS datasets
Integrated abundance110.0 ppm · rank 1229/3519 (65.1th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length247 aa
Molecular weight27.0 kDa
Theoretical pI9.66
GRAVY-0.008 (hydrophilic)
Aliphatic index88.5
Aromaticity0.113
Instability index32.7 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AcyltransferasePF01553.27 6.6e-3121–151 Acyltransferase

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 84.9

PDB hitprobTM-scoreE-valueDescription
5kym-assembly1_A 1.00 0.72 1.2e-11 sig 5kym-assembly1_A Crystal Structure of the 1-acyl-sn-glycerophosphate (LPA) acyltransferase, PlsC, from Thermotoga maritima
5kym-assembly2_B 1.00 0.72 1.6e-11 sig 5kym-assembly2_B Crystal Structure of the 1-acyl-sn-glycerophosphate (LPA) acyltransferase, PlsC, from Thermotoga maritima
1iuq-assembly1_A 1.00 0.54 3.0e-08 sig 1iuq-assembly1_A The 1.55 A Crystal Structure of Glycerol-3-Phosphate Acyltransferase
8ia1-assembly3_C 1.00 0.56 4.4e-07 sig 8ia1-assembly3_C plastidial glycerol-3-phosphate acyltransferases (GPAT) from the green alga Myrmecia incisa

Foldseek search of the AlphaFold DB model (mean pLDDT 84.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv2181 (+ strand, 0 bp gap)
Downstream (3' on genome)Rv2183c (- strand, 85 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2881c cdsA exp phosphatidate cytidylyltransferase 960 905 database:900 textmining:604
Rv2482c plsB2 exp glycerol-3-phosphate acyltransferase 925 905 database:900
Rv1551 plsB1 exp acyltransferase PlsB 908 904 database:900
Rv2252 dagK exp diacylglycerol kinase 906 903 database:900
Rv2289 cdh exp CDP-diacylglycerol pyrophosphatase 901 901 database:900
Rv2982c gpdA2 exp glycerol-3-phosphate dehydrogenase 923 891 database:800
Rv0564c gpdA1 exp glycerol-3-phosphate dehydrogenase 878 852 database:800
Rv2184c hyp hypothetical protein 819 819 ctx neighborhood:782
Rv3302c glpD2 exp glycerol-3-phosphate dehydrogenase 818 809 database:800
Rv2249c glpD1 exp glycerol-3-phosphate dehydrogenase 817 808 database:800
Rv2183c hyp hypothetical protein 784 784 ctx neighborhood:782
Rv2185c TB16.3 hyp hypothetical protein 707 707 ctx neighborhood:702
Rv0425c ctpH exp metal cation transporting ATPase H 479 478 database:451
Rv1997 ctpF exp cation transporter ATPase F 466 466 database:451
Rv0908 ctpE exp metal cation transporter ATPase E 466 466 database:451

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 1-acylglycerol-3-phosphate O-acyltransferase
  • MTBC0 PGAP product: lysophospholipid acyltransferase family protein
  • Pfam (hmmscan --cut_ga): Acyltransferase PF01553.27 (E=7e-31)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216698.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acyltransferase (PF01553.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0204
  • Curated reference: UniProt O53516 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 84.9)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 35 functional partner(s)
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002317|Rv2182c|
MWYYLFKYIFMGPLFTLLGRPKVEGLEYIPSSGPAILASNHLAVADSFYLPLVVRRRIWFLAKSEYFTGTGLKGWINRWFYSVSGQVPIDRTNADSAQGALQTAVVLLGQGKLLGMYPEGTRSPDGRLYKGKTGLARLALHTGVPVIPVAMIGTNVVNPPGRKMLRFGRVTVRFGKPMDFSRFEGLAGNHFIERAVTDEVIYELMGLSGQEYVDIYAASVKDGRNAGGAGANPNSTDAARIPETAAG