mraZ Resolved · high auto-curated
H37Rv Rv2166c · MTBC0 mtbc0_002302 ·
143 aa · 2456792–2457223 (-) ·
RefSeq NP_216682.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transcriptional regulator MraZ |
|---|---|
| MTBC0 PGAP re-annotation | division/cell wall cluster transcriptional repressor MraZ |
| Revised (this work) | Division/cell wall cluster transcriptional repressor MraZ. Pfam: MraZ (PF02381.24). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJN9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Transcriptional regulator MraZ |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| Preferred name | mraZ |
| eggNOG description | Belongs to the MraZ family |
| Orthologous group | COG2001 |
| KEGG orthology |
K03925
|
| Gene Ontology (57) |
GO:0000976, GO:0001067, GO:0003674, GO:0003676, GO:0003677, GO:0003690, GO:0003700, GO:0005488, GO:0006355, GO:0008150, GO:0009889, GO:0009890 +45 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.6 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MraZ | PF02381.24 | 2.2e-22 | 73–140 | MraZ protein, putative antitoxin-like |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: rsmH (rRNA small subunit methyltransferase H), high confidence from genomic context alone (score 995 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2165c rsmH |
rRNA small subunit methyltransferase H | 999 | 995 ctx | neighborhood:817 coexpression:968 textmining:920 |
Rv2163c pbpB |
penicillin-binding membrane protein PbpB | 951 | 886 ctx | neighborhood:816 textmining:594 |
Rv2164c hyp |
hypothetical protein | 978 | 837 ctx | neighborhood:816 textmining:876 |
Rv2748c ftsK |
DNA translocase FtsK | 623 | 599 ctx | cooccurence:568 |
Rv2169c |
transmembrane protein | 598 | 598 ctx | neighborhood:593 |
Rv2157c murF |
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase | 659 | 555 ctx | neighborhood:488 |
Rv1650 pheT |
phenylalanine--tRNA ligase subunit beta | 548 | 549 | |
Rv2158c murE |
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase | 595 | 541 ctx | neighborhood:520 |
Rv2156c murX |
phospho-N-acetylmuramoyl-pentappeptidetransferase | 500 | 500 ctx | neighborhood:498 |
Rv3917c parB |
chromosome partitioning protein ParB | 443 | 443 ctx | cooccurence:420 |
Rv2162c PE_PGRS38 |
PE-PGRS family protein PE_PGRS38 | 440 | 440 ctx | neighborhood:440 |
Rv2155c murD |
UDP-N-acetylmuramoylalanine--D-glutamate ligase | 555 | 419 ctx | neighborhood:415 |
Rv2167c |
Probable transposase; Rv2167c, (MTCY270.01), len: 328 aa. Probable IS6110 transposase. Identical to many other M. tuberculosis IS6110 transp | 406 | 406 ctx | neighborhood:406 |
Rv2168c |
Rv2168c, (MTV021.01c), len: 108 aa. Putative transposase for IS6110 (fragment), identical to many other Mycobacterium tuberculosis IS6110 tr | 406 | 406 ctx | neighborhood:406 |
Rv2154c ftsW |
lipid II flippase FtsW | 474 | 404 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transcriptional regulator MraZ
- MTBC0 PGAP product: division/cell wall cluster transcriptional repressor MraZ
- Pfam (hmmscan --cut_ga): MraZ PF02381.24 (E=2e-22)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216682.1)
- Domains: Pfam-A via hmmscan --cut_ga — MraZ (PF02381.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2001 - Curated reference: UniProt P9WJN9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
31 functional partner(s); context anchor
rsmH - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002302|Rv2166c|mraZ MFLGTYTPKLDDKGRLTLPAKFRDALAGGLMVTKSQDHSLAVYPRAAFEQLARRASKAPRSNPEARAFLRNLAAGTDEQHPDSQGRITLSADHRRYASLSKDCVVIGAVDYLEIWDAQAWQNYQQIHEENFSAASDEALGDIF