mraZ Resolved · high auto-curated

H37Rv Rv2166c · MTBC0 mtbc0_002302 · 143 aa · 2456792–2457223 (-) · RefSeq NP_216682.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator MraZ
MTBC0 PGAP re-annotationdivision/cell wall cluster transcriptional repressor MraZ
Revised (this work)Division/cell wall cluster transcriptional repressor MraZ. Pfam: MraZ (PF02381.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJN9 SwissProt · reviewed · Evidence at protein level
UniProt nameTranscriptional regulator MraZ

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namemraZ
eggNOG descriptionBelongs to the MraZ family
Orthologous groupCOG2001
KEGG orthology K03925
Gene Ontology (57) GO:0000976, GO:0001067, GO:0003674, GO:0003676, GO:0003677, GO:0003690, GO:0003700, GO:0005488, GO:0006355, GO:0008150, GO:0009889, GO:0009890 +45 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.6 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MraZPF02381.24 2.2e-2273–140 MraZ protein, putative antitoxin-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rsmH (rRNA small subunit methyltransferase H), high confidence from genomic context alone (score 995 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2165c rsmH rRNA small subunit methyltransferase H 999 995 ctx neighborhood:817 coexpression:968 textmining:920
Rv2163c pbpB penicillin-binding membrane protein PbpB 951 886 ctx neighborhood:816 textmining:594
Rv2164c hyp hypothetical protein 978 837 ctx neighborhood:816 textmining:876
Rv2748c ftsK DNA translocase FtsK 623 599 ctx cooccurence:568
Rv2169c transmembrane protein 598 598 ctx neighborhood:593
Rv2157c murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase 659 555 ctx neighborhood:488
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 548 549
Rv2158c murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase 595 541 ctx neighborhood:520
Rv2156c murX phospho-N-acetylmuramoyl-pentappeptidetransferase 500 500 ctx neighborhood:498
Rv3917c parB chromosome partitioning protein ParB 443 443 ctx cooccurence:420
Rv2162c PE_PGRS38 PE-PGRS family protein PE_PGRS38 440 440 ctx neighborhood:440
Rv2155c murD UDP-N-acetylmuramoylalanine--D-glutamate ligase 555 419 ctx neighborhood:415
Rv2167c Probable transposase; Rv2167c, (MTCY270.01), len: 328 aa. Probable IS6110 transposase. Identical to many other M. tuberculosis IS6110 transp 406 406 ctx neighborhood:406
Rv2168c Rv2168c, (MTV021.01c), len: 108 aa. Putative transposase for IS6110 (fragment), identical to many other Mycobacterium tuberculosis IS6110 tr 406 406 ctx neighborhood:406
Rv2154c ftsW lipid II flippase FtsW 474 404

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator MraZ
  • MTBC0 PGAP product: division/cell wall cluster transcriptional repressor MraZ
  • Pfam (hmmscan --cut_ga): MraZ PF02381.24 (E=2e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216682.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MraZ (PF02381.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2001
  • Curated reference: UniProt P9WJN9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 31 functional partner(s); context anchor rsmH
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002302|Rv2166c|mraZ
MFLGTYTPKLDDKGRLTLPAKFRDALAGGLMVTKSQDHSLAVYPRAAFEQLARRASKAPRSNPEARAFLRNLAAGTDEQHPDSQGRITLSADHRRYASLSKDCVVIGAVDYLEIWDAQAWQNYQQIHEENFSAASDEALGDIF