Rv2189c Still unknown · low

H37Rv Rv2189c · MTBC0 mtbc0_002324 · 257 aa · 2477254–2478027 (-) · RefSeq NP_216705.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical; function unknown. Structure-based hint rejected: the real M1 alanyl-aminopeptidase PepN is Rv2467 (paralogue-of-fold).

Curated reference (UniProt)

UniProt O53523 TrEMBL · unreviewed · Predicted
UniProt nameDUF4157 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
eggNOG descriptionaminopeptidase N
Orthologous groupCOG0308

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.092 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 11.00% of strains (15978) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 89.1 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
4arf-assembly1_A 1.00 0.49 4.0e-04 sig 4arf-assembly1_A CRYSTAL STRUCTURE OF THE PEPTIDASE DOMAIN OF COLLAGENASE H FROM CLOSTRIDIUM HISTOLYTICUM IN COMPLEX WITH THE PEPTIDIC INHIBITOR ISOAMYLPHOSPHONYL-GLY-PRO-ALA AT 1.77 ANGSTROM RESOLUTION.
4r5t-assembly1_A 1.00 0.53 1.7e-03 sig 4r5t-assembly1_A Structure of the m1 alanylaminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor
8t83-assembly1_A 1.00 0.52 1.6e-03 sig 8t83-assembly1_A X-ray crystal structure of PfA-M1(M462K)
6u7f-assembly2_B 1.00 0.53 2.5e-03 sig 6u7f-assembly2_B HCoV-229E RBD Class IV in complex with human APN
6oiu-assembly4_D 1.00 0.50 1.5e-03 sig 6oiu-assembly4_D X-ray crystal structure of the ectodomain of the Toxoplasma gondii ME49 Aminopeptidase N (TGME49_224350)
2y50-assembly1_A 1.00 0.49 2.8e-03 sig 2y50-assembly1_A Crystal Structure of Collagenase G from Clostridium histolyticum at 2. 80 Angstrom Resolution
6oiu-assembly3_C 1.00 0.51 4.7e-03 sig 6oiu-assembly3_C X-ray crystal structure of the ectodomain of the Toxoplasma gondii ME49 Aminopeptidase N (TGME49_224350)
4are-assembly1_A 1.00 0.47 2.8e-03 sig 4are-assembly1_A Crystal structure of the collagenase Unit of collagenase G from Clostridium histolyticum at 2.19 angstrom resolution.

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ripC (endopeptidase), high confidence from genomic context alone (score 791 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2190c ripC endopeptidase 798 791 ctx neighborhood:752
Rv2188c pimB alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase 779 780 ctx neighborhood:775
Rv3446c hyp hypothetical protein 677 657 ctx cooccurence:599
Rv1362c membrane protein 660 645 ctx cooccurence:594
Rv0651 rplJ 50S ribosomal protein L10 634 621 database:546
Rv0513 transmembrane protein 618 619 ctx cooccurence:613
Rv1363c membrane protein 625 608 ctx cooccurence:552
Rv0250c hyp hypothetical protein 606 607 ctx cooccurence:603
Rv0703 rplW 50S ribosomal protein L23 612 603 database:546
Rv0715 rplX 50S ribosomal protein L24 600 601 database:546
Rv3339c icd1 isocitrate dehydrogenase 626 590 database:526
Rv3068c pgmA phosphoglucomutase PgmA 611 588 database:519
Rv2438c nadE glutamine-dependent NAD(+) synthetase 590 566 database:486
Rv1972 Mce associated membrane protein 583 564 ctx cooccurence:503
Rv0174 mce1F Mce family protein Mce1F 562 562 ctx cooccurence:550

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Structural Foldseek hit not propagated -- the real M1 alanyl-aminopeptidase PepN is Rv2467 (paralogue-of-fold)
  • Reviewed against literature (extended structural cross-check, 2026-06-02)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216705.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0308
  • Curated reference: UniProt O53523 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 89.1, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 66 functional partner(s); context anchor ripC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002324|Rv2189c|
MRDGPAAPAQVVAPADGFVALRVADDRTVRLLSLGGAATDRLLSRIAAGIDAAVDEVVAFWGTDWSHDIFVVAAGSDEQFHAAAGGGLASQWADIAAITVVDRVDPARRTVVGQRIVFAPGAAHMSPAALRIVLGHELFHYAARADTALDAPRWLAEGVADFVARPKTPPPADAVSVALSLPSDTDLDTPGPQRSLAYDRAWWFARFVAAAYGTAKLRELYLATCGVGHFDLATAAHDVLGIDAAGLLARWQRWLMG