idsA2 Resolved · high auto-curated

H37Rv Rv2173 · MTBC0 mtbc0_002307 · 352 aa · 2460854–2461912 (+) · RefSeq NP_216689.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)geranylgeranyl pyrophosphate synthetase IdsA
MTBC0 PGAP re-annotationbifunctional (2E%2C6E)-farnesyl/geranyl diphosphate synthase
Revised (this work)Bifunctional (2E%2C6E)-farnesyl/geranyl diphosphate synthase. Pfam: polyprenyl_synt (PF00348.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53507 SwissProt · reviewed · Evidence at protein level
UniProt name(2E,6E)-farnesyl diphosphate synthase
EC (curated) EC 2.5.1.1, EC 2.5.1.10
Curated functionCatalyzes the sequential condensations of isopentenyl pyrophosphate (IPP) with dimethylallyl diphosphate (DMAPP) to yield geranyl diphosphate (GPP) and with GPP to yield (2E,6E)-farnesyl diphosphate (E,E-FPP).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namecrtE
eggNOG descriptionBelongs to the FPP GGPP synthase family
Orthologous groupCOG0142
EC number EC 2.5.1.1, EC 2.5.1.10, EC 2.5.1.29
KEGG orthology K13787
KEGG pathways map00900, map01100, map01110, map01130
KEGG modules M00364, M00365

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.183 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
polyprenyl_syntPF00348.23 2.3e-4636–290 Polyprenyl synthetase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1086 ((2Z,6E)-farnesyl diphosphate synthase), high confidence from genomic context alone (score 971 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1086 (2Z,6E)-farnesyl diphosphate synthase 986 971 ctx cooccurence:697 database:900 textmining:564
Rv1745c idi isopentenyl-diphosphate delta-isomerase 982 950 database:900 textmining:670
Rv0562 grcC1 polyprenyl-diphosphate synthase GrcC 946 924 database:900
Rv0989c grcC2 polyprenyl-diphosphate synthase GrcC 943 918 database:900
Rv3383c idsB polyprenyl synthetase IdsB 941 918 database:900
Rv3398c idsA1 multifunctional dimethylallyltransferase/geranyltranstransferase/farnesyltranstransferase 943 916 database:900
Rv2174 mptA alpha(1->6)-mannopyranosyltransferase A 949 911 ctx neighborhood:882 textmining:455
Rv3382c lytB1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 983 906 database:900 textmining:828
Rv1110 lytB2 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 970 906 database:900 textmining:702
Rv3397c phyA phytoene synthase 954 886 database:800 textmining:620
Rv2172c hyp hypothetical protein 749 736 ctx neighborhood:706
Rv2361c uppS decaprenyl diphosphate synthase 863 694 ctx cooccurence:666 textmining:572
Rv2752c rnj ribonuclease J 529 530 coexpression:514
Rv0721 rpsE 30S ribosomal protein S5 526 526 coexpression:411
Rv1107c xseB exodeoxyribonuclease VII small subunit 552 516 coexpression:417

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: geranylgeranyl pyrophosphate synthetase IdsA
  • MTBC0 PGAP product: bifunctional (2E%2C6E)-farnesyl/geranyl diphosphate synthase
  • Pfam (hmmscan --cut_ga): polyprenyl_synt PF00348.23 (E=2e-46)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216689.1)
  • Domains: Pfam-A via hmmscan --cut_ga — polyprenyl_synt (PF00348.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0142
  • Curated reference: UniProt O53507 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor Rv1086
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002307|Rv2173|idsA2
MAGAITDQLRRYLHGRRRAAAHMGSDYDGLIADLEDFVLGGGKRLRPLFAYWGWHAVASREPDPDVLLLFSALELLHAWALVHDDLIDRSATRRGRPTAQLRYAALHRDRDWRGSPDQFGMSAAILLGDLAQVWADDIVSKVCQSALAPDAQRRVHRVWADIRNEVLGGQYLDIVAEASAAESIESAMNVATLKTACYTVSRPLQLGTAAAADRSDVAAIFEHFGADLGVAFQLRDDVLGVFGDPAVTGKPSGDDLKSGKRTVLVAEAVELADRSDPLAAKLLRTSIGTRLTDAQVRELRTVIEAVGARAAAESRIAALTQRALATLASAPINATAKAGLSELAMMAANRSA