idsA2 Resolved · high auto-curated
H37Rv Rv2173 · MTBC0 mtbc0_002307 ·
352 aa ·
2460854–2461912 MTBC0
(+) ·
RefSeq NP_216689.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | geranylgeranyl pyrophosphate synthetase IdsA |
|---|---|
| MTBC0 PGAP re-annotation | bifunctional (2E%2C6E)-farnesyl/geranyl diphosphate synthase |
| Revised (this work) | Bifunctional (2E%2C6E)-farnesyl/geranyl diphosphate synthase. Pfam: polyprenyl_synt (PF00348.23). |
| Functional category (TubercuList) | lipid metabolism |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 3 publications
3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Development of Thieno[2,3-b]pyridin-6(7H)-one derivatives against drug-resistant Mycobacterium tuberculosis. doi:10.1016/j.bmc.2026.118663 | 2026 |
| Structures of Mycobacterium tuberculosis isoprenyl diphosphate synthase Rv2173 in substrate-bound forms. doi:10.1107/S2053230X25002298 | 2025 |
| Insight into Isoprenoid Biosynthesis by Functional Analysis of Isoprenyl Diphosphate Synthases from Mycobacterium vanbaalenii and Mycobacterium tuberculosis. doi:10.1002/cbic.202000235 | 2020 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -1.90 (95% CI -4.65 to 1.55). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in lipid biosynthesis. |
|---|---|
| Mycobrowser EC |
2.5.1.-
· superseded EC numbering; the atlas uses the current class (2.5.1.1, 2.5.1.10, 2.5.1.29)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2195
· 99.7% identity |
|---|---|
| M. marinum |
MMAR_3208
· 74.7% identity |
| M. smegmatis |
MSMEG_4240
· 65.1% identity |
| M. orygis |
RJtmp_002242
· 99.7% identity |
| M. abscessus |
MAB_1992c
· 57.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53507
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | (2E,6E)-farnesyl diphosphate synthase |
| EC (curated) |
EC 2.5.1.1, EC 2.5.1.10
|
| Curated function | Catalyzes the sequential condensations of isopentenyl pyrophosphate (IPP) with dimethylallyl diphosphate (DMAPP) to yield geranyl diphosphate (GPP) and with GPP to yield (2E,6E)-farnesyl diphosphate (E,E-FPP). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | crtE |
| eggNOG description | Belongs to the FPP GGPP synthase family |
| Orthologous group | COG0142 |
| EC number |
EC 2.5.1.1, EC 2.5.1.10, EC 2.5.1.29
|
| KEGG orthology |
K13787
|
| KEGG pathways |
map00900, map01100, map01110, map01130
|
| KEGG modules |
M00364, M00365
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.183 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 74.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 46.4% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 19 in the ORF — 0 in the essential state, 0 growth-defect, 19 non-essential, 0 growth-advantage. Saturation 0.842, mean read count 36.4375. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| altered fitness under Ethambutol (drug exposure) | +7.35 | 0.0 | disruption advantageous |
| altered fitness under Isoniazid (drug exposure) | +5.02 | 0.0 | disruption advantageous |
| altered fitness under Isoniazid (drug exposure) | +2.94 | 0.0 | disruption advantageous |
| altered fitness under 6 weeks hypoxia (stress) | +1.96 | 0.0061 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.87 | 0.0 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 5 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 21.9 ppm · rank 2283/3519 (35.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 352 aa |
|---|---|
| Molecular weight | 37.8 kDa |
| Theoretical pI | 6.26 |
| GRAVY | -0.022 (hydrophilic) |
| Aliphatic index | 98.9 |
| Aromaticity | 0.057 |
| Instability index | 37.3 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
polyprenyl_synt | PF00348.23 | 2.3e-46 | 36–290 | Polyprenyl synthetase |
Experimental structures (Protein Data Bank) 3 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
8f8f |
X-ray diffraction | 2.0 Å | 100% |
8f8k |
X-ray diffraction | 2.2 Å | 100% |
8f8l |
X-ray diffraction | 2.2 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (3 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8f8k-assembly1_A |
1.00 | 0.98 | 4.8e-44 sig | 8f8k-assembly1_A The structure of Rv2173 from M. tuberculosis with IPP bound |
3qqv-assembly1_A-2 |
1.00 | 0.95 | 7.6e-27 sig | 3qqv-assembly1_A-2 Crystal structure of geranylgeranyl pyrophosphate synthase from corynebacterium glutamicum complexed with isoprenyl diphosphate and magnesium |
3lk5-assembly1_A-2 |
1.00 | 0.90 | 7.1e-22 sig | 3lk5-assembly1_A-2 Crystal structure of putative Geranylgeranyl pyrophosphate synthase from Corynebacterium glutamicum |
1wy0-assembly1_A-2 |
1.00 | 0.84 | 1.1e-14 sig | 1wy0-assembly1_A-2 Crystal structure of geranylgeranyl pyrophosphate synthetase from Pyrococcus horikoshii Ot3 |
6kd7-assembly1_A |
1.00 | 0.83 | 3.0e-13 sig | 6kd7-assembly1_A Crystal structure of geranylgeranyl pyrophosphate synthase |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv2172c (- strand, 310 bp gap) |
|---|---|
| Downstream (3' on genome) | mptA (+ strand, 3 bp gap) |
| Predicted operon |
idsA2 · mptA
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
whiB5 (represses) · mmpR5 (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv1086 ((2Z,6E)-farnesyl diphosphate synthase), high confidence from genomic context alone (score 971 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1086 exp |
(2Z,6E)-farnesyl diphosphate synthase | 986 | 971 ctx | cooccurence:697 database:900 textmining:564 |
Rv1745c idi exp |
isopentenyl-diphosphate delta-isomerase | 982 | 950 | database:900 textmining:670 |
Rv0562 grcC1 exp |
polyprenyl-diphosphate synthase GrcC | 946 | 924 | database:900 |
Rv0989c grcC2 exp |
polyprenyl-diphosphate synthase GrcC | 943 | 918 | database:900 |
Rv3383c idsB exp |
polyprenyl synthetase IdsB | 941 | 918 | database:900 |
Rv3398c idsA1 exp |
multifunctional dimethylallyltransferase/geranyltranstransferase/farnesyltranstransferase | 943 | 916 | database:900 |
Rv2174 mptA |
alpha(1->6)-mannopyranosyltransferase A | 949 | 911 ctx | neighborhood:882 textmining:455 |
Rv3382c lytB1 exp |
4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 983 | 906 | database:900 textmining:828 |
Rv1110 lytB2 exp |
4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 970 | 906 | database:900 textmining:702 |
Rv3397c phyA exp |
phytoene synthase | 954 | 886 | database:800 textmining:620 |
Rv2172c hyp |
hypothetical protein | 749 | 736 ctx | neighborhood:706 |
Rv2361c uppS |
decaprenyl diphosphate synthase | 863 | 694 ctx | cooccurence:666 textmining:572 |
Rv2752c rnj |
ribonuclease J | 529 | 530 | coexpression:514 |
Rv0721 rpsE |
30S ribosomal protein S5 | 526 | 526 | coexpression:411 |
Rv1107c xseB |
exodeoxyribonuclease VII small subunit | 552 | 516 | coexpression:417 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: geranylgeranyl pyrophosphate synthetase IdsA
- MTBC0 PGAP product: bifunctional (2E%2C6E)-farnesyl/geranyl diphosphate synthase
- Pfam (hmmscan --cut_ga): polyprenyl_synt PF00348.23 (E=2e-46)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216689.1)
- Domains: Pfam-A via hmmscan --cut_ga — polyprenyl_synt (PF00348.23)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0142 - Curated reference: UniProt O53507 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
42 functional partner(s); context anchor
Rv1086 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002307|Rv2173|idsA2 MAGAITDQLRRYLHGRRRAAAHMGSDYDGLIADLEDFVLGGGKRLRPLFAYWGWHAVASREPDPDVLLLFSALELLHAWALVHDDLIDRSATRRGRPTAQLRYAALHRDRDWRGSPDQFGMSAAILLGDLAQVWADDIVSKVCQSALAPDAQRRVHRVWADIRNEVLGGQYLDIVAEASAAESIESAMNVATLKTACYTVSRPLQLGTAAAADRSDVAAIFEHFGADLGVAFQLRDDVLGVFGDPAVTGKPSGDDLKSGKRTVLVAEAVELADRSDPLAAKLLRTSIGTRLTDAQVRELRTVIEAVGARAAAESRIAALTQRALATLASAPINATAKAGLSELAMMAANRSA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for idsA2? Email the maintainer — the message is pre-filled with this gene's details.