Rv3412 Still unknown · low auto-curated

H37Rv Rv3412 · MTBC0 mtbc0_003626 · 136 aa · 3857165–3857575 (+) · RefSeq NP_217929.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF5319 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF5319. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKY9 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv3412

UniProt still lists this protein as Uncharacterized protein Rv3412; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionFamily of unknown function (DUF5319)
Orthologous group2DHRC

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.306 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF5319PF17252.8 7.9e-489–122 Family of unknown function (DUF5319)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: guaB2 (inosine-5'-monophosphate dehydrogenase), high confidence from genomic context alone (score 760 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3411c guaB2 inosine-5'-monophosphate dehydrogenase 760 760 ctx neighborhood:756
Rv3410c guaB3 oxidoreductase 746 746 ctx neighborhood:744
Rv2179c 3'-5' exoribonuclease 728 728 ctx cooccurence:728
Rv3605c hyp hypothetical protein 728 728 ctx cooccurence:728
Rv3231c hyp hypothetical protein 717 717 ctx cooccurence:716
Rv2744c 35kd_ag hyp hypothetical protein 714 714 ctx cooccurence:710
Rv2170 GCN5-like N-acetyltransferase 686 686 ctx cooccurence:686
Rv2468c hyp hypothetical protein 663 663 ctx cooccurence:659
Rv3519 hyp hypothetical protein 569 570 ctx cooccurence:555
Rv0948c chorismate mutase 524 525 ctx cooccurence:518
Rv3221A rshA anti-sigma factor RshA 524 524 ctx cooccurence:498
Rv3205c hyp hypothetical protein 504 505 ctx cooccurence:486
Rv1638A hyp hypothetical protein 497 497 ctx cooccurence:492
Rv3409c choD cholesterol oxidase 495 494 ctx neighborhood:487
Rv1343c lprD lipoprotein LprD 489 489 ctx cooccurence:476

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF5319 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF5319 PF17252.8 (E=8e-48)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217929.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF5319 (PF17252.8)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DHRC
  • Curated reference: UniProt P9WKY9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 86.6, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 47 functional partner(s); context anchor guaB2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003626|Rv3412|
MRDHLPPGLPPDPFADDPCDPSAALEAVEPGQPLDQQERMAVEADLADLAVYEALLAHKGIRGLVVCCDECQQDHYHDWDMLRSNLLQLLIDGTVRPHEPAYDPEPDSYVTWDYCRGYADASLNEAAPDADRFRRR