lppM Resolved · high auto-curated

H37Rv Rv2171 · MTBC0 mtbc0_002305 · 227 aa · 2458958–2459641 (+) · RefSeq NP_216687.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LppM
MTBC0 PGAP re-annotationlipoprotein LppM
Revised (this work)Lipoprotein LppM. Pfam: LppM (PF21946.2).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53505 SwissProt · reviewed · Evidence at protein level
UniProt nameProtein LppM
Curated functionA putative lipoprotein that seems to be specialized for the initial steps of macrophage infection. A non-acylated fragment (residues 26-185) binds phosphatidyl-myo-inositol mannosides (PIMs). Limits, in a TLR2-dependent fashion, bacterial uptake by host (mouse); this effect may be mediated by nonacylated fragment 26-185. Plays a TLR2-dependent role in host phagosome maturation arrest. Plays a TLR2-independent role in chemokine production during the first 24 hours of mouse infection.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Preferred namelppM
Orthologous group2E8DR
Gene Ontology (54) GO:0002682, GO:0002683, GO:0005575, GO:0005618, GO:0005623, GO:0008150, GO:0009605, GO:0009607, GO:0030312, GO:0031347, GO:0031348, GO:0035821 +42 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.6 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LppMPF21946.2 1.7e-5327–178 LppM domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2170 (GCN5-like N-acetyltransferase), high confidence from genomic context alone (score 776 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2170 GCN5-like N-acetyltransferase 775 776 ctx neighborhood:775
Rv2732c transmembrane protein 763 763 ctx cooccurence:762
Rv3205c hyp hypothetical protein 754 755 ctx cooccurence:745
Rv0010c membrane protein 735 735 ctx cooccurence:734
Rv1100 hyp hypothetical protein 720 720 ctx cooccurence:720
Rv0358 hyp hypothetical protein 716 717 ctx cooccurence:716
Rv0556 transmembrane protein 713 714 ctx cooccurence:713
Rv3850 hyp hypothetical protein 705 706 ctx cooccurence:704
Rv1109c hyp hypothetical protein 694 695 ctx cooccurence:694
Rv0431 tuberculin-like peptide 686 687 ctx cooccurence:684
Rv3755c hyp hypothetical protein 676 676 ctx cooccurence:676
Rv1638A hyp hypothetical protein 665 665 ctx cooccurence:664
Rv2446c integral membrane protein 659 659 ctx cooccurence:658
Rv3212 hyp hypothetical protein 659 659 ctx cooccurence:648
Rv3839 hyp hypothetical protein 655 655 ctx cooccurence:655

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LppM
  • MTBC0 PGAP product: lipoprotein LppM
  • Pfam (hmmscan --cut_ga): LppM PF21946.2 (E=2e-53)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216687.1)
  • Domains: Pfam-A via hmmscan --cut_ga — LppM (PF21946.2)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E8DR
  • Curated reference: UniProt O53505 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 93 functional partner(s); context anchor Rv2170
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002305|Rv2171|lppM
MARTRRRGMLAIAMLLMLVPLATGCLRVRASITISPDDLVSGEIIAAAKPKNSKDTGPALDGDVPFSQKVAVSNYDSDGYVGSQAVFSDLTFAELPQLANMNSDAAGVNLSLRRNGNIVILEGRADLTSVSDPDADVELTVAFPAAVTSTNGDRIEPEVVQWKLKPGVVSTMSAQARYTDPNTRSFTGAGIWLGIAAFAAAGVVAVLAWIDRDRSPRLTASGDPPTS