pimB Resolved · high auto-curated

H37Rv Rv2188c · MTBC0 mtbc0_002323 · 385 aa · 2476000–2477157 MTBC0 (-) · RefSeq NP_216704.2

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase
MTBC0 PGAP re-annotationGDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase
Revised (this work)GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase. Pfam: Glyco_transf_4 (PF13439.13), GT4-conflict (PF20706.4), Glycos_transf_1 (PF00534.27), Glyco_trans_1_4 (PF13692.13), Glyco_trans_1_2 (PF13524.13).
Functional category (TubercuList)lipid metabolism

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 17 publications

17 TB publications mention this gene. 17 publication(s) discuss this gene (14 in a M. tuberculosis context, 4 in other mycobacteria — M. smegmatis (4)).

Most recent 5 of 17.
PublicationDate
Label-free electrochemical-based biosensor for gene-phosphatidylinositol mannosides detection in urine for the determination of multidrug-resistant tuberculosis. doi:10.1088/1361-6528/ae0b79 2025
A putative mycobacterial GDP-mannose dependent α-mannosyltransferase Rv0225 acts as PimC: an in-silico study. doi:10.1080/07391102.2024.2437686 2026
Mycobacterium tuberculosis Adaptation in Response to Isoniazid Treatment in a Multi-Stress System That Mimics the Host Environment. doi:10.3390/antibiotics12050852 2023
In-silico identification of critical residues in the mannose-transfer mechanism of phosphatidyl-myo-inositol mannosyltransferase B'. doi:10.1016/j.bbrc.2022.06.087 2022
The Regulation of ManLAM-Related Gene Expression in Mycobacterium tuberculosis with Different Drug Resistance Profiles Following Isoniazid Treatment. doi:10.2147/IDR.S346869 2022

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -2.75 (95% CI -3.39 to -2.10). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in lipoarabinomannan (lam) biosynthesis
Mycobrowser EC 2.4.1.57 · superseded EC numbering; the atlas uses the current class (2.4.1.346)

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2211c · 99.7% identity
M. leprae ML0886 · 81.5% identity
M. marinum MMAR_3232 · 85.7% identity
M. smegmatis MSMEG_4253 · 71.7% identity
M. orygis RJtmp_002258 · 99.7% identity
M. abscessus MAB_1976 · 70.2% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WMZ3 SwissProt · reviewed · Evidence at protein level
UniProt nameGDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase
EC (curated) EC 2.4.1.346
Curated functionInvolved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM). Catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 6 of a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1) to generate phosphatidyl-myo-inositol bearing alpha-1,2- and alpha-1,6-linked mannose residues (Ac1PIM2). PimB also catalyzes the addition of a mannosyl residue from GDP-Man to the position 6 of phosphatidyl-myo-inositol bearing an acylated alpha-1,2-lin.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namepimB
eggNOG descriptionGDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase
Orthologous groupCOG0438
EC number EC 2.4.1.346
KEGG orthology K13668
CAZy family GT4
Gene Ontology (38) GO:0000009, GO:0000030, GO:0003674, GO:0003824, GO:0004376, GO:0005575, GO:0005623, GO:0005886, GO:0006629, GO:0006643, GO:0006664, GO:0008150 +26 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.949 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 82.8% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 9/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 57.5%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 19 in the ORF — 19 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 10 of 16 independent MS datasets
Integrated abundance12.7 ppm · rank 2574/3519 (26.9th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length385 aa
Molecular weight41.2 kDa
Theoretical pI9.57
GRAVY-0.009 (hydrophilic)
Aliphatic index90.8
Aromaticity0.065
Instability index33.6 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Glyco_transf_4PF13439.13 9.4e-1616–177 Glycosyltransferase Family 4
GT4-conflictPF20706.4 1.9e-09134–374 Family 4 Glycosyltransferase in conflict systems
Glycos_transf_1PF00534.27 4.3e-44186–360 Glycosyl transferases group 1
Glyco_trans_1_4PF13692.13 2.2e-34197–345 Glycosyl transferases group 1
Glyco_trans_1_2PF13524.13 6.4e-06255–375 Glycosyl transferase-like

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.4

PDB hitprobTM-scoreE-valueDescription
3oka-assembly1_A 1.00 0.93 2.6e-43 sig 3oka-assembly1_A Crystal structure of Corynebacterium glutamicum PimB' in complex with GDP-Man (triclinic crystal form)
4xsp-assembly1_B 1.00 0.83 7.4e-23 sig 4xsp-assembly1_B Crystal structure of Anabaena Alr3699/HepE in complex with UDP
4xsu-assembly1_B 1.00 0.79 2.7e-22 sig 4xsu-assembly1_B Crystal structure of Anabaena Alr3699/HepE in complex with UDP and glucose
3mbo-assembly3_F 1.00 0.81 9.3e-22 sig 3mbo-assembly3_F Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate
3mbo-assembly2_C 1.00 0.76 6.7e-22 sig 3mbo-assembly2_C Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate

Foldseek search of the AlphaFold DB model (mean pLDDT 95.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)fadD15 (+ strand, 30 bp gap)
Downstream (3' on genome)Rv2189c (- strand, 96 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) Rv2034 (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2611c (phosphatidylinositol mannoside acyltransferase), high confidence from genomic context alone (score 960 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2611c exp phosphatidylinositol mannoside acyltransferase 997 960 ctx cooccurence:594 database:900 textmining:928
Rv2610c pimA exp alpha-(1-2)-phosphatidylinositol mannosyltransferase 952 928 database:900
Rv1326c glgB exp 1,4-alpha-glucan branching protein 819 781 coexpression:407 database:572
Rv1562c treZ exp malto-oligosyltrehalose trehalohydrolase 809 781 coexpression:409 database:572
Rv2189c hyp hypothetical protein 779 780 ctx neighborhood:775
Rv2529 hyp exp hypothetical protein 674 662 database:516
Rv3231c hyp hypothetical protein 618 618 ctx cooccurence:618
Rv2190c ripC endopeptidase 706 608 ctx neighborhood:551
Rv0322 udgA UDP-glucose 6-dehydrogenase UdgA 563 535 coexpression:448
Rv3264c manB D-alpha-D-mannose-1-phosphate guanylyltransferase ManB 554 527
Rv2307c hyp exp hypothetical protein 544 522 experimental:443
Rv3909 hyp hypothetical protein 507 496 ctx cooccurence:494
Rv3809c glf UDP-galactopyranose mutase 584 487 coexpression:470
Rv1328 glgP glycogen phosphorylase 523 480
Rv3658c transmembrane protein 479 479 ctx cooccurence:476

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase
  • MTBC0 PGAP product: GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase
  • Pfam (hmmscan --cut_ga): Glyco_transf_4 PF13439.13 (E=9e-16), GT4-conflict PF20706.4 (E=2e-09), Glycos_transf_1 PF00534.27 (E=4e-44), Glyco_trans_1_4 PF13692.13 (E=2e-34), Glyco_trans_1_2 PF13524.13 (E=6e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216704.2)
  • Domains: Pfam-A via hmmscan --cut_ga — Glyco_transf_4 (PF13439.13), GT4-conflict (PF20706.4), Glycos_transf_1 (PF00534.27), Glyco_trans_1_4 (PF13692.13), Glyco_trans_1_2 (PF13524.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0438
  • Curated reference: UniProt P9WMZ3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.4)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 50 functional partner(s); context anchor Rv2611c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002323|Rv2188c|pimB
MSRVLLVTNDFPPRRGGIQSYLGEFVGRLVGSRAHAMTVYAPQWKGADAFDDAARAAGYRVVRHPSTVMLPGPTVDVRMRRLIAEHDIETVWFGAAAPLALLAPRARLAGASRVLASTHGHEVGWSMLPVARSVLRRIGDGTDVVTFVSSYTRSRFASAFGPAASLEYLPPGVDTDRFRPDPAARAELRKRYRLGERPTVVCLSRLVPRKGQDTLVTALPSIRRRVDGAALVIVGGGPYLETLRKLAHDCGVADHVTFTGGVATDELPAHHALADVFAMPCRTRGAGMDVEGLGIVFLEASAAGVPVIAGNSGGAPETVQHNKTGLVVDGRSVDRVADAVAELLIDRDRAVAMGAAGREWVTAQWRWDTLAAKLADFLRGDDAAR