tgs1 Resolved · high auto-curated
H37Rv Rv3130c · MTBC0 mtbc0_003327 ·
463 aa · 3516340–3517731 (-) ·
RefSeq NP_217646.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | diacyglycerol O-acyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | diacylglycerol O-acyltransferase |
| Revised (this work) | Diacylglycerol O-acyltransferase. Pfam: WS_DGAT_cat (PF03007.22), WS_DGAT_C (PF06974.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WKC9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable diacyglycerol O-acyltransferase tgs1 |
| EC (curated) |
EC 2.3.1.20
|
| Curated function | Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for storage lipid synthesis (Probable)..; FUNCTION: Upon expression in E.coli functions as a triacylglycerol synthase, making triacylglycerol (TG) from diolein and long-chain fatty acyl-CoA. Prefers C(26:0)-CoA over C(18:1)-CoA. TG synthesis activity increases in M.tuberculosis upon oxygen depletion and NO treatment, with concomitant accumulation of TG in inclusion bodies. As disruption of the gene encoding this protein obviates TG synthesis this seems . |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | Belongs to the long-chain O-acyltransferase family |
| Orthologous group | COG1020 |
| EC number |
EC 2.3.1.20
|
| KEGG orthology |
K00635
|
| KEGG pathways |
map00561, map01100
|
| KEGG modules |
M00089
|
| Gene Ontology (60) |
GO:0000302, GO:0001666, GO:0003674, GO:0003824, GO:0004144, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006629, GO:0006638, GO:0006639 +48 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.561 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
WS_DGAT_cat | PF03007.22 | 4.3e-82 | 4–256 | Wax ester synthase/diacylglycerol acyltransferase catalytic domain |
WS_DGAT_C | PF06974.19 | 2.4e-28 | 299–441 | WS/DGAT C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv3131 (NAD(P)H nitroreductase), high confidence from genomic context alone (score 949 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3131 |
NAD(P)H nitroreductase | 980 | 949 ctx | neighborhood:506 coexpression:863 textmining:626 |
Rv2627c hyp |
hypothetical protein | 922 | 919 ctx | cooccurence:432 coexpression:804 |
Rv3097c lipY |
triacylglycerol lipase Lip | 925 | 901 | database:900 |
Rv2252 dagK |
diacylglycerol kinase | 900 | 900 | database:900 |
Rv3127 hyp |
hypothetical protein | 913 | 889 | coexpression:863 |
Rv2032 acg |
NAD(P)H nitroreductase | 925 | 874 | coexpression:835 textmining:438 |
Rv2031c hspX |
alpha-crystallin | 942 | 862 | coexpression:861 textmining:602 |
Rv1738 hyp |
hypothetical protein | 909 | 861 | coexpression:861 |
Rv0079 hyp |
hypothetical protein | 901 | 860 | coexpression:860 |
Rv1996 |
universal stress protein | 878 | 860 | coexpression:860 |
Rv2007c fdxA |
ferredoxin | 921 | 836 | coexpression:836 textmining:541 |
Rv3134c |
universal stress protein | 879 | 813 | coexpression:813 |
Rv2626c hrp1 |
hypoxic response protein | 867 | 811 | coexpression:810 |
Rv0080 hyp |
hypothetical protein | 852 | 803 | coexpression:803 |
Rv1733c |
transmembrane protein | 845 | 802 | coexpression:802 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: diacyglycerol O-acyltransferase
- MTBC0 PGAP product: diacylglycerol O-acyltransferase
- Pfam (hmmscan --cut_ga): WS_DGAT_cat PF03007.22 (E=4e-82), WS_DGAT_C PF06974.19 (E=2e-28)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217646.1)
- Domains: Pfam-A via hmmscan --cut_ga — WS_DGAT_cat (PF03007.22), WS_DGAT_C (PF06974.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1020 - Curated reference: UniProt P9WKC9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
46 functional partner(s); context anchor
Rv3131 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003327|Rv3130c|tgs1 MNHLTTLDAGFLKAEDVDRHVSLAIGALAVIEGPAPDQEAFLSSLAQRLRPCTRFGQRLRLRPFDLGAPKWVDDPDFDLGRHVWRIALPRPGNEDQLFELIADLMARRLDRGRPLWEVWVIEGLADSKWAILTKLHHCMADGIAATHLLAGLSDESMSDSFASNIHTTMQSQSASVRRGGFRVNPSEALTASTAVMAGIVRAAKGASEIAAGVLSPAASSLNGPISDLRRYSAAKVPLADVEQVCRKFDVTINDVALAAITESYRNVLIQRGERPRFDSLRTLVPVSTRSNSALSKTDNRVSLMLPNLPVDQENPLQRLRIVHSRLTRAKAGGQRQFGNTLMAIANRLPFPMTAWAVGLLMRLPQRGVVTVATNVPGPRRPLQIMGRRVLDLYPVSPIAMQLRTSVAMLSYADDLYFGILADYDVVADAGQLARGIEDAVARLVAISKRRKVTRRRGALSLVV