fdxA Family assigned · medium auto-curated
H37Rv Rv2007c · MTBC0 mtbc0_002135 ·
114 aa ·
2279697–2280041 MTBC0
(-) ·
RefSeq NP_216523.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ferredoxin |
|---|---|
| MTBC0 PGAP re-annotation | ferredoxin family protein |
| Revised (this work) | Ferredoxin family protein. Pfam: Fer4 (PF00037.33). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 12 publications
12 TB publications mention this gene. 12 publication(s) discuss this gene (12 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Expression of Resuscitation-Promoting Factor C Stimulates the Growth of Mycobacterium bovis BCG and Delays DevR Regulon Activation in Hypoxia. doi:10.1155/ijm/2139933 | 2025 |
| Use of DosR and Rpf antigens from Mycobacterium tuberculosis to screen for latent and relapse tuberculosis infection in a tuberculosis endemic community of Huainan City. doi:10.1007/s10096-022-04459-8 | 2022 |
| Functional insights into Mycobacterium tuberculosis DevR-dependent transcriptional machinery utilizing Escherichia coli. doi:10.1042/BCJ20210268 | 2021 |
| Function, essentiality, and expression of cytochrome P450 enzymes and their cognate redox partners in Mycobacterium tuberculosis: are they drug targets? doi:10.1007/s00253-019-09697-z | 2019 |
| Pharmacologic ascorbate as a pro-drug for hydrogen peroxide release to kill mycobacteria. doi:10.1016/j.biopha.2018.11.078 | 2019 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 32% of residues (metapredict) · mean AlphaFold pLDDT 95.4 |
|---|---|
| Disordered regions | 1 IDR(s), longest 36 aa [78-114] |
carries a substantial disordered region (36/114 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Conditional expression context (iModulons)
Member of 2 independently-modulated gene set(s):
DevR-1 (devR), DevR-2 (devR).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.49 (95% CI -1.34 to 2.79). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in electron transfer. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2030c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_2994
· 78.9% identity |
| M. smegmatis |
MSMEG_1124
· 68.8% identity |
| M. orygis |
RJtmp_002075
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WNE7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Ferredoxin |
| Curated function | Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | fdxA |
| eggNOG description | ferredoxin |
| Orthologous group | COG1146 |
| Gene Ontology (28) |
GO:0001666, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006950, GO:0008150, GO:0009605, GO:0009607, GO:0009628, GO:0036293 +16 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 74.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 63.0% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 9 in the ORF — 0 in the essential state, 0 growth-defect, 9 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 115.111111111. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness after prolonged in vitro passage (in vitro passage) | -3.15 | 0.031 | required |
| fitness in mouse infection (in vivo) | +1.22 | 0.047 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 772.0 ppm · rank 288/3519 (91.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 114 aa |
|---|---|
| Molecular weight | 12.1 kDa |
| Theoretical pI | 4.18 |
| GRAVY | 0.145 (hydrophobic) |
| Aliphatic index | 84.6 |
| Aromaticity | 0.061 |
| Instability index | 40.5 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Fer4 | PF00037.33 | 1.7e-06 | 34–56 | 4Fe-4S binding domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2v2k-assembly2_B |
1.00 | 0.96 | 8.9e-14 sig | 2v2k-assembly2_B THE CRYSTAL STRUCTURE OF FDXA, A 7FE FERREDOXIN FROM MYCOBACTERIUM SMEGMATIS |
1g3o-assembly1_A |
1.00 | 0.98 | 9.3e-09 sig | 1g3o-assembly1_A CRYSTAL STRUCTURE OF V19E MUTANT OF FERREDOXIN I |
1h98-assembly1_A |
1.00 | 0.98 | 1.3e-08 sig | 1h98-assembly1_A New Insights into Thermostability of Bacterial Ferredoxins: High Resolution Crystal Structure of the Seven-Iron Ferredoxin from Thermus thermophilus |
1gao-assembly4_D |
1.00 | 0.98 | 1.5e-08 sig | 1gao-assembly4_D CRYSTAL STRUCTURE OF THE L44S MUTANT OF FERREDOXIN I |
1b0t-assembly1_A |
1.00 | 0.98 | 2.0e-08 sig | 1b0t-assembly1_A D15K/K84D MUTANT OF AZOTOBACTER VINELANDII FDI |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | otsB1 (+ strand, 98 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2008c (- strand, 188 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
Rv1353c (represses) · devR (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1996 |
universal stress protein | 902 | 881 | coexpression:860 |
Rv2031c hspX |
alpha-crystallin | 947 | 860 | coexpression:860 textmining:640 |
Rv3134c |
universal stress protein | 914 | 850 | coexpression:850 textmining:452 |
Rv3127 hyp |
hypothetical protein | 854 | 849 | coexpression:846 |
Rv1738 hyp |
hypothetical protein | 933 | 845 | coexpression:845 textmining:586 |
Rv3131 |
NAD(P)H nitroreductase | 937 | 836 | coexpression:833 textmining:632 |
Rv3130c tgs1 |
diacyglycerol O-acyltransferase | 921 | 836 | coexpression:836 textmining:541 |
Rv2623 TB31.7 |
universal stress protein | 903 | 836 | coexpression:831 textmining:433 |
Rv2626c hrp1 |
hypoxic response protein | 902 | 834 | coexpression:834 textmining:434 |
Rv0080 hyp |
hypothetical protein | 868 | 824 | coexpression:819 |
Rv0079 hyp |
hypothetical protein | 878 | 821 | coexpression:820 |
Rv2032 acg |
NAD(P)H nitroreductase | 859 | 814 | coexpression:810 |
Rv1813c hyp |
hypothetical protein | 864 | 801 | coexpression:801 |
Rv2627c hyp |
hypothetical protein | 797 | 797 | coexpression:797 |
Rv1733c |
transmembrane protein | 806 | 748 | coexpression:748 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ferredoxin
- MTBC0 PGAP product: ferredoxin family protein
- Pfam (hmmscan --cut_ga): Fer4 PF00037.33 (E=2e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216523.1)
- Domains: Pfam-A via hmmscan --cut_ga — Fer4 (PF00037.33)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1146 - Curated reference: UniProt P9WNE7 (SwissProt, reviewed; Evidence at protein level)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s)
- Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002135|Rv2007c|fdxA MTYVIGSECVDVMDKSCVQECPVDCIYEGARMLYINPDECVDCGACKPACRVEAIYWEGDLPDDQHQHLGDNAAFFHQVLPGRVAPLGSPGGAAAVGPIGVDTPLVAAIPVECP
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for fdxA? Email the maintainer — the message is pre-filled with this gene's details.