Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ferredoxin |
|---|
| MTBC0 PGAP re-annotation | ferredoxin family protein |
|---|
| Revised (this work) | Ferredoxin family protein. Pfam: Fer4 (PF00037.33). |
|---|
Auto-curated: this verdict and function were generated by rules from
PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WNE7
SwissProt · reviewed
· Evidence at protein level
|
|---|
| UniProt name | Ferredoxin |
|---|
| Curated function | Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. |
|---|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|
| Preferred name | fdxA |
|---|
| eggNOG description | ferredoxin |
|---|
| Orthologous group | COG1146 |
|---|
| Gene Ontology (28) |
GO:0001666, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006950, GO:0008150, GO:0009605, GO:0009607, GO:0009628, GO:0036293 +16 more
|
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are
computed annotations, not manual curation; cross-check against the primary literature
before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|
Fer4 | PF00037.33 |
1.7e-06 | 34–56 |
4Fe-4S binding domain |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|
Rv1996 |
universal stress protein |
902 |
881 |
coexpression:860 |
Rv2031c hspX |
alpha-crystallin |
947 |
860 |
coexpression:860 textmining:640 |
Rv3134c |
universal stress protein |
914 |
850 |
coexpression:850 textmining:452 |
Rv3127 hyp |
hypothetical protein |
854 |
849 |
coexpression:846 |
Rv1738 hyp |
hypothetical protein |
933 |
845 |
coexpression:845 textmining:586 |
Rv3131 |
NAD(P)H nitroreductase |
937 |
836 |
coexpression:833 textmining:632 |
Rv3130c tgs1 |
diacyglycerol O-acyltransferase |
921 |
836 |
coexpression:836 textmining:541 |
Rv2623 TB31.7 |
universal stress protein |
903 |
836 |
coexpression:831 textmining:433 |
Rv2626c hrp1 |
hypoxic response protein |
902 |
834 |
coexpression:834 textmining:434 |
Rv0080 hyp |
hypothetical protein |
868 |
824 |
coexpression:819 |
Rv0079 hyp |
hypothetical protein |
878 |
821 |
coexpression:820 |
Rv2032 acg |
NAD(P)H nitroreductase |
859 |
814 |
coexpression:810 |
Rv1813c hyp |
hypothetical protein |
864 |
801 |
coexpression:801 |
Rv2627c hyp |
hypothetical protein |
797 |
797 |
coexpression:797 |
Rv1733c |
transmembrane protein |
806 |
748 |
coexpression:748 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression,
experimental, database, text-mining) into a 0–1000 score. The ctx
badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion,
phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an
unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not
depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with
the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ferredoxin
- MTBC0 PGAP product: ferredoxin family protein
- Pfam (hmmscan --cut_ga): Fer4 PF00037.33 (E=2e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024),
An imputed ancestral reference genome for the MTBC,
doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216523.1)
- Domains: Pfam-A via hmmscan --cut_ga — Fer4 (PF00037.33)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1146
- Curated reference: UniProt
P9WNE7
(SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
39 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002135|Rv2007c|fdxA
MTYVIGSECVDVMDKSCVQECPVDCIYEGARMLYINPDECVDCGACKPACRVEAIYWEGDLPDDQHQHLGDNAAFFHQVLPGRVAPLGSPGGAAAVGPIGVDTPLVAAIPVECP
Spot an error? Suggest an improvement