Rv1738 Family assigned · medium auto-curated

H37Rv Rv1738 · MTBC0 mtbc0_001851 · 94 aa · 1977729–1978013 (+) · RefSeq NP_216254.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF1876 domain-containing protein
Revised (this work)DUF1876 domain-containing protein. Pfam: Rv2632c-like (PF08962.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLS3 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv1738

UniProt still lists this protein as Uncharacterized protein Rv1738; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF1876)
Orthologous group2EH65
Gene Ontology (27) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0008150, GO:0009605, GO:0009607, GO:0016020, GO:0040007, GO:0043207 +15 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.635 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 6.16% of strains (8951) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rv2632c-likePF08962.17 2.2e-3211–90 Rv2632c-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3131 (NAD(P)H nitroreductase), high confidence from genomic context alone (score 915 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3127 hyp hypothetical protein 954 922 ctx cooccurence:465 coexpression:860 textmining:436
Rv3131 NAD(P)H nitroreductase 937 915 ctx cooccurence:419 coexpression:860
Rv2031c hspX alpha-crystallin 963 906 coexpression:860 textmining:630
Rv1996 universal stress protein 922 906 coexpression:861
Rv2032 acg NAD(P)H nitroreductase 979 900 ctx cooccurence:438 coexpression:829 textmining:804
Rv3134c universal stress protein 975 882 ctx cooccurence:424 coexpression:803 textmining:803
Rv1737c narK2 nitrate/nitrite transporter 925 872 ctx neighborhood:449 coexpression:778 textmining:436
Rv0080 hyp hypothetical protein 895 867 coexpression:804
Rv3130c tgs1 diacyglycerol O-acyltransferase 909 861 coexpression:861
Rv0079 hyp hypothetical protein 949 860 coexpression:860 textmining:654
Rv2007c fdxA ferredoxin 933 845 coexpression:845 textmining:586
Rv1733c transmembrane protein 922 845 coexpression:797 textmining:518
Rv2626c hrp1 hypoxic response protein 960 806 coexpression:805 textmining:803
Rv2623 TB31.7 universal stress protein 926 800 coexpression:735 textmining:650
Rv2627c hyp hypothetical protein 797 797 coexpression:797

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF1876 domain-containing protein
  • Pfam (hmmscan --cut_ga): Rv2632c-like PF08962.17 (E=2e-32)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216254.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rv2632c-like (PF08962.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EH65
  • Curated reference: UniProt P9WLS3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 31 functional partner(s); context anchor Rv3131
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001851|Rv1738|
MCGDQSDHVLQHWTVDISIDEHEGLTRAKARLRWREKELVGVGLARLNPADRNVPEIGDELSVARALSDLGKRMLKVSTHDIEAVTHQPARLLY