mce3A Family assigned · medium auto-curated

H37Rv Rv1966 · MTBC0 - · 425 aa · 2209327–2210604 (+) · RefSeq YP_177852.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)Mce family protein Mce3A
MTBC0 PGAP re-annotation
Revised (this work)Mce family protein Mce3A. Pfam: MlaD (PF02470.26), Mce4_CUP1 (PF11887.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N698 TrEMBL · unreviewed · Predicted
UniProt nameMce-family protein Mce3A

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
Preferred namemce3A
eggNOG descriptionVirulence factor Mce family protein
Orthologous groupCOG1463
KEGG orthology K02067
KEGG pathways map02010
KEGG modules M00210, M00669, M00670

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.106 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MlaDPF02470.26 2.7e-1541–120 MlaD protein
Mce4_CUP1PF11887.14 8.9e-80127–346 Cholesterol uptake porter CUP1 of Mce4, putative

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: yrbE3B (integral membrane protein), high confidence from genomic context alone (score 995 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1965 yrbE3B integral membrane protein 998 995 ctx neighborhood:785 cooccurence:757 coexpression:881 textmining:659
Rv1964 yrbE3A integral membrane protein 997 994 ctx neighborhood:782 cooccurence:690 coexpression:878 textmining:602
Rv1970 lprM Mce family lipoprotein LprM 998 993 ctx neighborhood:783 cooccurence:774 coexpression:860 textmining:824
Rv1968 mce3C Mce family protein Mce3C 997 993 ctx neighborhood:787 cooccurence:774 coexpression:860 textmining:687
Rv1969 mce3D Mce family protein Mce3D 997 993 ctx neighborhood:784 cooccurence:774 coexpression:859 textmining:687
Rv1971 mce3F Mce family protein Mce3F 995 993 ctx neighborhood:787 cooccurence:774 coexpression:860 textmining:443
Rv1967 mce3B Mce family protein Mce3B 997 992 ctx neighborhood:781 cooccurence:772 coexpression:860 textmining:673
Rv1972 Mce associated membrane protein 993 987 ctx neighborhood:714 cooccurence:767 coexpression:820 textmining:547
Rv1973 Mce associated membrane protein 986 982 ctx neighborhood:715 cooccurence:737 coexpression:785
Rv1974 membrane protein 946 856 ctx neighborhood:691 coexpression:553 textmining:644
Rv0168 yrbE1B membrane protein 903 854 ctx cooccurence:736
Rv3500c yrbE4B integral membrane protein 866 854 ctx cooccurence:740
Rv0588 yrbE2B hyp hypothetical protein 889 853 ctx cooccurence:732
Rv0655 mkl ABC transporter ATP-binding protein 895 847 ctx cooccurence:684 experimental:431
Rv3501c yrbE4A integral membrane protein 844 841 ctx cooccurence:710

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): Mce family protein Mce3A
  • Pfam (hmmscan --cut_ga): MlaD PF02470.26 (E=3e-15), Mce4_CUP1 PF11887.14 (E=9e-80)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177852.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MlaD (PF02470.26), Mce4_CUP1 (PF11887.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1463
  • Curated reference: UniProt L7N698 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 58 functional partner(s); context anchor yrbE3B
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1966|mce3A
MRRGPGRHRLHDAWWTLILFAVIGVAVLVTAVSFTGSLRSTVPVTLAADRSGLVMDSGAKVMMRGVQVGRVAQIGRIEWAQNGASLRLEIDPDQIRYIPANVEAQISATTAFGAKFVDLVMPQNPSRARLSAGAVLHSKNVSTEINTVFENVVDLLNMIDPLKLNAVLTAVADAVRGQGERIGQATTDLNEVLEALNARGDTIGGNWRSLKNFTDTYDAAAQDILTILNAASTTSATVVNHSTQLDALLLNAIGLSNAGTNLLGSSRDNLVGAADILAPTTSLLFKYNPEYTCFLQGAKWYLDNGGYAAWGGADGRTLQLDVALLFGNDPYVYPDNLPVVAAKGGPGGRPGCGPLPDATHNFPVRQLVTNTGWGTGLDIRPNPGIGHPCWANYFPVTRAVPEPPSIRQCIPGPAIGPNPAAGEQP