Rv1974 Still unknown · low auto-curated

H37Rv Rv1974 · MTBC0 mtbc0_002090 · 125 aa · 2236776–2237153 (+) · RefSeq NP_216490.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationDUF732 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF732. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53975 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF732)
Orthologous group29G9E

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.17 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF732PF05305.20 1.0e-1040–108 Protein of unknown function (DUF732)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1972 (Mce associated membrane protein), high confidence from genomic context alone (score 972 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1972 Mce associated membrane protein 994 972 ctx neighborhood:869 coexpression:797 textmining:803
Rv1971 mce3F Mce family protein Mce3F 956 956 ctx neighborhood:839 coexpression:738
Rv1973 Mce associated membrane protein 943 944 ctx neighborhood:763 coexpression:772
Rv1970 lprM Mce family lipoprotein LprM 969 934 ctx neighborhood:692 coexpression:796 textmining:549
Rv1975 hyp hypothetical protein 983 882 ctx neighborhood:863 textmining:868
Rv1966 mce3A Mce family protein Mce3A 946 856 ctx neighborhood:691 coexpression:553 textmining:644
Rv1968 mce3C Mce family protein Mce3C 854 854 ctx neighborhood:806
Rv1967 mce3B Mce family protein Mce3B 819 819 ctx neighborhood:709 coexpression:404
Rv1964 yrbE3A integral membrane protein 788 789 ctx neighborhood:759
Rv1965 yrbE3B integral membrane protein 914 764 ctx neighborhood:692 textmining:650
Rv1969 mce3D Mce family protein Mce3D 950 756 ctx neighborhood:691 textmining:803
Rv1976c hyp hypothetical protein 869 52 textmining:868
Rv1977 hyp hypothetical protein 454 52 textmining:448
Rv0222 echA1 enoyl-CoA hydratase EchA1 803 41 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: DUF732 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF732 PF05305.20 (E=1e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216490.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF732 (PF05305.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 29G9E
  • Curated reference: UniProt O53975 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor Rv1972
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002090|Rv1974|
MQRQSLMPQQTLAAGVFVGALLCGVVTAAVPPHARADVVAYLVNVTVRPGYNFANADAALSYGHGLCEKVSRGRPYAQIIADVKADFDTRDQYQASYLLSQAVNELCPALIWQLRNSAVDNRRSG