Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
| MTBC0 PGAP re-annotation | NYN domain-containing protein |
| Revised (this work) | NYN domain-containing protein. Pfam: NYN_YacP (PF05991.18). |
Auto-curated: this verdict and function were generated by rules from
PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53977
TrEMBL · unreviewed
· Evidence at protein level
|
| UniProt name | RNA-binding protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
| eggNOG description | YacP-like NYN domain |
| Orthologous group | COG3688 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are
computed annotations, not manual curation; cross-check against the primary literature
before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS |
0.35 · purifying
|
| Polymorphic sites (≥ 0.1% of strains) |
2 synonymous, 2 missense, 0 nonsense, 0 frameshift
|
pN/pS from segregating SNPs (singletons removed) normalised by possible sites.
Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene).
A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic
variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A
clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a
convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
NYN_YacP | PF05991.18 |
6.7e-09 | 4–125 |
YacP-like NYN domain |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
Rv2130c mshC |
cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase |
706 |
700 |
coexpression:683 |
Rv3580c cysS1 |
cysteine--tRNA ligase |
702 |
696 |
coexpression:679 |
Rv3579c rlmB |
23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB |
519 |
497 |
coexpression:480 |
Rv0881 |
tRNA/rRNA methyltransferase |
516 |
494 |
coexpression:477 |
Rv1644 tsnR |
23S rRNA methyltransferase TsnR |
516 |
494 |
coexpression:477 |
Rv0380c |
RNA methyltransferase |
516 |
494 |
coexpression:477 |
Rv3577 hyp |
hypothetical protein |
468 |
469 ctx |
cooccurence:467 |
Rv0182c sigG |
ECF RNA polymerase sigma factor SigG |
409 |
410 |
|
Rv3223c sigH |
ECF RNA polymerase sigma factor SigH |
409 |
410 |
|
Rv3681c whiB4 |
transcriptional regulator WhiB4 |
409 |
409 |
|
Rv3328c sigJ |
ECF RNA polymerase sigma factor SigJ |
409 |
409 |
|
Rv1221 sigE |
ECF RNA polymerase sigma factor SigE |
409 |
409 |
|
Rv1189 sigI |
ECF RNA polymerase sigma factor SigI |
408 |
408 |
|
Rv1322 hyp |
hypothetical protein |
408 |
408 |
|
Rv3911 sigM |
ECF RNA polymerase sigma factor SigM |
406 |
407 |
|
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression,
experimental, database, text-mining) into a 0–1000 score. The ctx
badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion,
phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an
unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not
depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with
the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: NYN domain-containing protein
- Pfam (hmmscan --cut_ga): NYN_YacP PF05991.18 (E=7e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024),
An imputed ancestral reference genome for the MTBC,
doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216492.1)
- Domains: Pfam-A via hmmscan --cut_ga — NYN_YacP (PF05991.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3688
- Curated reference: UniProt
O53977
(TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of
145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
24 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002092|Rv1976c|
MRWIVDGMNVIGSRPDGWWRDRHRAMVMLVERLEGWAITKARGDDVTVVFERPPSTAIPSSVVEVAHAPKAAANSADDEIVRLVRSGAQPQEIRVVTSDKALTDRVRDLGAAVYPAERFRDLIDPRGSNAARRTQ
Spot an error? Suggest an improvement