Rv1907c Still unknown · low auto-curated

H37Rv Rv1907c · MTBC0 - · 215 aa · 2153235–2153882 (-) · RefSeq NP_216423.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF4262. Function unknown. Foldseek best (non-significant) hit: 4q3o-assembly4_H Crystal structure of MGS-MT1, an alpha/beta hydrolase (prob 0.04, TM 0.35).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L0TAY1 TrEMBL · unreviewed · Predicted
UniProt nameDUF4262 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF4262)
Orthologous group2C8CM

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 1.008 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 3 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 12.15% of strains (17644) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4262PF14081.12 1.5e-3183–197 Domain of unknown function (DUF4262)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 79.1 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
4q3o-assembly4_H 0.04 0.35 2.7e+00 4q3o-assembly4_H Crystal structure of MGS-MT1, an alpha/beta hydrolase enzyme from a Lake Matapan deep-sea metagenome library
6mrs-assembly1_A 0.03 0.25 1.6e+00 6mrs-assembly1_A De novo designed protein Peak6
7z5u-assembly1_A 0.03 0.41 6.6e+00 7z5u-assembly1_A Crystal structure of the peptidase domain of collagenase G from Clostridium histolyticum in complex with a hydroxamate-based inhibitor
2qg7-assembly2_D 0.03 0.28 3.0e+00 2qg7-assembly2_D Plasmodium vivax ethanolamine kinase Pv091845
6cib-assembly6_F 0.02 0.31 6.2e+00 6cib-assembly6_F The structure of YcaO from Methanopyrus kandleri bound with AMPPCP and Mg2+
4uoi-assembly4_F 0.02 0.39 9.5e+00 4uoi-assembly4_F Unexpected structure for the N-terminal domain of Hepatitis C virus envelope glycoprotein E1
3aac-assembly1_B 0.02 0.41 7.9e+00 3aac-assembly1_B Small heat shock protein hsp14.0 with the mutations of I120F and I122F in the form II crystal
4q05-assembly1_B 0.02 0.20 1.6e+00 4q05-assembly1_B Crystal structure of an esterase E25

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: katG (catalase-peroxidase), high confidence from genomic context alone (score 945 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1908c katG catalase-peroxidase 957 945 ctx neighborhood:805 coexpression:731
Rv0330c hyp hypothetical protein 727 727 ctx cooccurence:719
Rv1909c furA ferric uptake regulation protein FurA 831 712 ctx neighborhood:698 textmining:438
Rv0093c membrane protein 637 638 ctx cooccurence:636
Rv0034 hyp hypothetical protein 605 606 ctx cooccurence:600
Rv2209 integral membrane protein 602 603 ctx cooccurence:600
Rv2775 GCN5-like N-acetyltransferase 588 589 ctx cooccurence:588
Rv0355c PPE8 PPE family protein PPE8 578 578 ctx cooccurence:576
Rv3350c PPE56 PPE family protein PPE56 575 575 ctx cooccurence:574
Rv3347c PPE55 PPE family protein PPE55 569 569 ctx cooccurence:567
Rv1004c membrane protein 566 567 ctx cooccurence:562
Rv1752 hyp hypothetical protein 566 566 ctx cooccurence:564
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 558 558 ctx cooccurence:558
Rv2305 hyp hypothetical protein 556 556 ctx cooccurence:556
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 552 552 ctx cooccurence:552

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF4262 PF14081.12 (E=1e-31)
  • Foldseek best: 4q3o-assembly4_H Crystal structure of MGS-MT1, an alpha/beta hydrolase enzyme fr (prob 0.04, E=3e+00, TM=0.35)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216423.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4262 (PF14081.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2C8CM
  • Curated reference: UniProt L0TAY1 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 79.1, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 64 functional partner(s); context anchor katG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1907c|
MIGPARRSTTTRRSTPRADRLAGCWCLPGAICQTPRAWWSQARRDGDDETGMRRKGAEMCWMCDHPEATAEEYLDEVYGIMLMHGWAVQHVECERRPFAYTVGLTRRGLPELVVTGLSPRRGQRLLNIAARRALVGDLLTPGMQTTLPAGPLVETVQVTHPDAHLYCAIAIFGDKVTALQLVWADRRGRWPWAADFDEGRGTQPVLGMRATRRSA