Rv3530c Family assigned · medium auto-curated

H37Rv Rv3530c · MTBC0 mtbc0_003747 · 260 aa · 3990715–3991497 (-) · RefSeq NP_218047.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oxidoreductase
MTBC0 PGAP re-annotationSDR family oxidoreductase
Revised (this work)SDR family oxidoreductase. Pfam: adh_short (PF00106.32), KR (PF08659.17), adh_short_C2 (PF13561.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y3S9 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible oxidoreductase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionDehydrogenase
Orthologous groupCOG1028
Gene Ontology (33) GO:0003674, GO:0003824, GO:0004799, GO:0006725, GO:0006807, GO:0006950, GO:0006979, GO:0008150, GO:0008152, GO:0008168, GO:0009987, GO:0016491 +21 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.802 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
adh_shortPF00106.32 1.4e-408–199 short chain dehydrogenase
KRPF08659.17 1.7e-0811–184 KR domain
adh_short_C2PF13561.13 7.3e-5315–256 Enoyl-(Acyl carrier protein) reductase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3502c (3-oxoacyl-ACP reductase), high confidence from genomic context alone (score 769 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3529c hyp hypothetical protein 996 996 ctx neighborhood:881 fusion:487 cooccurence:630 coexpression:826
Rv3531c hyp hypothetical protein 996 972 ctx neighborhood:882 cooccurence:646 textmining:870
Rv2524c fas fatty acid synthase 826 800 coexpression:506 experimental:475
Rv3502c 3-oxoacyl-ACP reductase 768 769 ctx cooccurence:766
Rv1865c short-chain type dehydrogenase 776 768 ctx cooccurence:736
Rv0945 oxidoreductase 635 621 ctx cooccurence:570
Rv3570c hsaA flavin-dependent monooxygenase oxygenase subunit HsaA 585 585
Rv1882c short-chain type dehydrogenase/reductase 575 575 ctx cooccurence:566
Rv2509 cmrA short-chain type dehydrogenase/reductase 587 572 ctx cooccurence:514
Rv1937 oxygenase 604 557
Rv0310c hyp hypothetical protein 562 544 ctx cooccurence:460
Rv3541c chsH1 hyp hypothetical protein 552 533
Rv2299c htpG chaperone protein HtpG 539 520 database:450
Rv3526 kshA 3-ketosteroid-9-alpha-monooxygenase oxygenase subunit 529 512
Rv0073 glutamine ABC transporter ATP-binding protein 532 510 database:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: oxidoreductase
  • MTBC0 PGAP product: SDR family oxidoreductase
  • Pfam (hmmscan --cut_ga): adh_short PF00106.32 (E=1e-40), KR PF08659.17 (E=2e-08), adh_short_C2 PF13561.13 (E=7e-53)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218047.1)
  • Domains: Pfam-A via hmmscan --cut_ga — adh_short (PF00106.32), KR (PF08659.17), adh_short_C2 (PF13561.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1028
  • Curated reference: UniProt I6Y3S9 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 91 functional partner(s); context anchor Rv3502c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003747|Rv3530c|
MTGMLKRKVIVVSGVGPGLGTTLAHRCARDGADLVLAARSAERLDDVAKQIIDTGRRAVAVRTDITDDDDVSNLVQATLAAYGKADVLINNAFRVPSMKPLAGTTFEHIRDAIELSALGTLRLIQAFTPALAQSHGAIVNVNSMVIRHSQPKYGTYKMAKSVLLAMSHSLATELGEQGIRVNSVAPGYIWGDTLKSYFDHQAGKYGTTVDQIYQATAANSDLKRLPTEDEVASAILFLASDLASGITGQTLDVNCGEYHT